Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	5998
Gene name	Regulator of G protein signaling 3
Gene symbol	RGS3
Synonyms (NCBI Gene)	C2PARGP3
Chromosome	9
Chromosome location	9q32
Summary	This gene encodes a member of the regulator of G-protein signaling (RGS) family. This protein is a GTPase-activating protein that inhibits G-protein-mediated signal transduction. Alternative splicing and the use of alternative promoters results in multipl

109

Show/Hide all (109)

miRTarBase ID	miRNA	Experiments	Reference
MIRT000966	hsa-miR-126-3p	Luciferase reporter assay	18834857
MIRT000966	hsa-miR-126-3p	Reporter assay	21249429
MIRT021713	hsa-miR-133a-3p	Reporter assay	21249429
MIRT029621	hsa-miR-26b-5p	Microarray	19088304
MIRT000966	hsa-miR-126-3p	ImmunohistochemistryLuciferase reporter assayqRT-PCRWestern blot	27754994
MIRT000966	hsa-miR-126-3p	ImmunohistochemistryLuciferase reporter assayqRT-PCRWestern blot	27754994
MIRT1304351	hsa-miR-1237	CLIP-seq
MIRT1304352	hsa-miR-1248	CLIP-seq
MIRT1304353	hsa-miR-1256	CLIP-seq
MIRT1304354	hsa-miR-1267	CLIP-seq
MIRT1304355	hsa-miR-1294	CLIP-seq
MIRT1304356	hsa-miR-1302	CLIP-seq
MIRT1304357	hsa-miR-145	CLIP-seq
MIRT1304358	hsa-miR-15a	CLIP-seq
MIRT1304359	hsa-miR-15b	CLIP-seq
MIRT1304360	hsa-miR-16	CLIP-seq
MIRT1304361	hsa-miR-195	CLIP-seq
MIRT1304362	hsa-miR-2116	CLIP-seq
MIRT1304363	hsa-miR-2681	CLIP-seq
MIRT1304364	hsa-miR-2964a-5p	CLIP-seq
MIRT1304365	hsa-miR-3122	CLIP-seq
MIRT1304366	hsa-miR-3128	CLIP-seq
MIRT1304367	hsa-miR-3177-5p	CLIP-seq
MIRT1304368	hsa-miR-3182	CLIP-seq
MIRT1304369	hsa-miR-3183	CLIP-seq
MIRT1304370	hsa-miR-3199	CLIP-seq
MIRT1304371	hsa-miR-3909	CLIP-seq
MIRT1304372	hsa-miR-3913-3p	CLIP-seq
MIRT1304373	hsa-miR-3913-5p	CLIP-seq
MIRT1304374	hsa-miR-424	CLIP-seq
MIRT1304375	hsa-miR-4273	CLIP-seq
MIRT1304376	hsa-miR-4279	CLIP-seq
MIRT1304377	hsa-miR-4289	CLIP-seq
MIRT1304378	hsa-miR-4298	CLIP-seq
MIRT1304379	hsa-miR-4318	CLIP-seq
MIRT1304380	hsa-miR-4652-3p	CLIP-seq
MIRT1304381	hsa-miR-4677-5p	CLIP-seq
MIRT1304382	hsa-miR-4693-5p	CLIP-seq
MIRT1304383	hsa-miR-4710	CLIP-seq
MIRT1304384	hsa-miR-4720-5p	CLIP-seq
MIRT1304385	hsa-miR-4723-3p	CLIP-seq
MIRT1304386	hsa-miR-4799-3p	CLIP-seq
MIRT1304387	hsa-miR-489	CLIP-seq
MIRT1304388	hsa-miR-497	CLIP-seq
MIRT1304389	hsa-miR-544	CLIP-seq
MIRT1304390	hsa-miR-552	CLIP-seq
MIRT1304391	hsa-miR-635	CLIP-seq
MIRT1304392	hsa-miR-885-3p	CLIP-seq
MIRT1304393	hsa-miR-892a	CLIP-seq
MIRT1304394	hsa-miR-922	CLIP-seq
MIRT1304395	hsa-miR-1207-5p	CLIP-seq
MIRT1304396	hsa-miR-1827	CLIP-seq
MIRT1304397	hsa-miR-1909	CLIP-seq
MIRT1304398	hsa-miR-3144-5p	CLIP-seq
MIRT1304399	hsa-miR-3612	CLIP-seq
MIRT1304400	hsa-miR-3665	CLIP-seq
MIRT1304401	hsa-miR-4736	CLIP-seq
MIRT1304402	hsa-miR-4763-3p	CLIP-seq
MIRT1304403	hsa-miR-541	CLIP-seq
MIRT1304404	hsa-miR-650	CLIP-seq
MIRT1304405	hsa-miR-654-5p	CLIP-seq
MIRT1304406	hsa-miR-711	CLIP-seq
MIRT1304407	hsa-miR-940	CLIP-seq
MIRT2090200	hsa-miR-1913	CLIP-seq
MIRT2090201	hsa-miR-1976	CLIP-seq
MIRT2090202	hsa-miR-324-3p	CLIP-seq
MIRT2090203	hsa-miR-370	CLIP-seq
MIRT2090204	hsa-miR-4313	CLIP-seq
MIRT2090205	hsa-miR-501-3p	CLIP-seq
MIRT2090206	hsa-miR-502-3p	CLIP-seq
MIRT1304395	hsa-miR-1207-5p	CLIP-seq
MIRT2314928	hsa-miR-1321	CLIP-seq
MIRT1304396	hsa-miR-1827	CLIP-seq
MIRT1304399	hsa-miR-3612	CLIP-seq
MIRT1304400	hsa-miR-3665	CLIP-seq
MIRT2314929	hsa-miR-4270	CLIP-seq
MIRT2314930	hsa-miR-4441	CLIP-seq
MIRT1304401	hsa-miR-4736	CLIP-seq
MIRT2314931	hsa-miR-4739	CLIP-seq
MIRT2314932	hsa-miR-4756-5p	CLIP-seq
MIRT1304402	hsa-miR-4763-3p	CLIP-seq
MIRT1304403	hsa-miR-541	CLIP-seq
MIRT1304404	hsa-miR-650	CLIP-seq
MIRT1304405	hsa-miR-654-5p	CLIP-seq
MIRT1304407	hsa-miR-940	CLIP-seq
MIRT1304353	hsa-miR-1256	CLIP-seq
MIRT2611237	hsa-miR-127-5p	CLIP-seq
MIRT2611238	hsa-miR-150	CLIP-seq
MIRT2611239	hsa-miR-25	CLIP-seq
MIRT2611240	hsa-miR-3121-5p	CLIP-seq
MIRT2611241	hsa-miR-3135b	CLIP-seq
MIRT2611242	hsa-miR-32	CLIP-seq
MIRT2611243	hsa-miR-320e	CLIP-seq
MIRT2611244	hsa-miR-331-3p	CLIP-seq
MIRT2611245	hsa-miR-363	CLIP-seq
MIRT2611246	hsa-miR-367	CLIP-seq
MIRT2611247	hsa-miR-3910	CLIP-seq
MIRT2611248	hsa-miR-4325	CLIP-seq
MIRT2611249	hsa-miR-4434	CLIP-seq
MIRT2611250	hsa-miR-4516	CLIP-seq
MIRT2611251	hsa-miR-4531	CLIP-seq
MIRT2611252	hsa-miR-4713-5p	CLIP-seq
MIRT2611253	hsa-miR-4715-3p	CLIP-seq
MIRT2611254	hsa-miR-4790-3p	CLIP-seq
MIRT2611255	hsa-miR-532-3p	CLIP-seq
MIRT1304392	hsa-miR-885-3p	CLIP-seq
MIRT2611256	hsa-miR-92a	CLIP-seq
MIRT2611257	hsa-miR-92b	CLIP-seq
MIRT2611253	hsa-miR-4715-3p	CLIP-seq

Show/Hide all (18)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003924	Function	GTPase activity	IEA
GO:0003924	Function	GTPase activity	TAS
GO:0005096	Function	GTPase activator activity	IEA
GO:0005096	Function	GTPase activator activity	TAS	9858594
GO:0005515	Function	Protein binding	IPI	21044950, 25416956, 32296183
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	TAS	9858594
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0007186	Process	G protein-coupled receptor signaling pathway	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS
GO:0008277	Process	Regulation of G protein-coupled receptor signaling pathway	TAS	9858594
GO:0009968	Process	Negative regulation of signal transduction	IEA
GO:0016020	Component	Membrane	IEA

MIM	HGNC	e!Ensembl
602189	9999	ENSG00000138835

P49796

Protein name

Regulator of G-protein signaling 3 (RGP3) (RGS3)

Protein function

Down-regulates signaling from heterotrimeric G-proteins by increasing the GTPase activity of the alpha subunits, thereby driving them into their inactive GDP-bound form. Down-regulates G-protein-mediated release of inositol phosphates and activa

PDB

2F5Y , 2OJ4 , 3FBK

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00168	C2	150 → 258	C2 domain	Domain
PF00595	PDZ	299 → 373	PDZ domain	Domain
PF00615	RGS	1073 → 1188	Regulator of G protein signaling domain	Domain

Sequence

MPVIPALWEVEMGRSQGQEIETILANRSHSDSTPLPNFLSGSHRPECCTCRLLTASGAQD
SLPFGRRLYSGPWRSCEEVCHVSVLSVLSTSCGLSLSLPIFPGWMEWLSPDIALPRRDEW
TQTSPARKRITHAKVQGAGQLRLSIDAQDRVLLLHIIEGKGLISKQPGTCDPYVKISLIP
EDSRLRHQKTQTVPDCRDPAFHEHFFFPVQEEDDQKRLLVTVWNRASQSRQSGLIGCMSF
GVKSLLTPDKEISGWYYLLGEHLGRTKHLKVARRRLRPLRDPLLRMPGGGDTENGKKLKI
TIPRGKDGFGFTICCDSPVRVQAVDSGGPAERAGLQQLDTVLQLNERPVEHWKCVELAHE
IRSCPSEIILLVWRMVPQVKPGPDGGVLRRASCKSTHDLQSPPNKREKNCTHGVQARPEQ
RHSCHLVCDSSDGLLLGGWERYTEVAKRGGQHTLPALSRATAPTDPNYIILAPLNPGSQL
LRPVYQEDTIPEESGSPSKGKSYTGLGKKSRLMKTVQTMKGHGNYQNCPVVRPHATHSSY
GTYVTLAPKVLVFPVFVQPLDLCNPARTLLLSEELLLYEGRNKAAEVTLFAYSDLLLFTK
EDEPGRCDVLRNPLYLQSVKLQEGSSEDLKFCVLYLAEKAECLFTLEAHSQEQKKRVCWC
LSENIAKQQQLAASPPDSKMFETEADEKREMALEEGKGPGAEDSPPSKEPSPGQELPPGQ
DLPPNKDSPSGQEPAPSQEPLSSKDSATSEGSPPGPDAPPSKDVPPCQEPPPAQDLSPCQ
DLPAGQEPLPHQDPLLTKDLPAIQESPTRDLPPCQDLPPSQVSLPAKALTEDTMSSGDLL
AATGDPPAAPRPAFVIPEVRLDSTYSQKAGAEQGCSGDEEDAEEAEEVEEGEEGEEDEDE
DTSDDNYGERSEAKRSSMIETGQGAEGGLSLRVQNSLRRRTHSEGSLLQEPRGPCFASDT
TLHCSDGEGAASTWGMPSPSTLKKELGRNGGSMHHLSLFFTGHRKMSGADTVGDDDEASR
KRKSKNLAKDMKNKLGIFRRRNESPGAPPAGKADKMMKSFKPTSEEALKWGESLEKLLVH
KYGLAVFQAFLRTEFSEENLEFWLACEDFKKVKSQSKMASKAKKIFAEYIAIQACKEVNL
DSYTREHTKDNLQSVTRGCFDLAQKRIFGLMEKDSYPRFLRSDLYLDLINQKKMSPPL

Sequence length

1198

Interactions

View interactions

	KEGG		Reactome
	Axon guidance		G alpha (q) signalling events G alpha (i) signalling events

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (5)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ATRIAL FIBRILLATION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PRIMARY PULMONARY HYPERTENSION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (20)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Arteriosclerosis	Arteriosclerosis	BEFREE	28845525		★★★★★ ★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	26263491		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	28845525		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	36936167	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	36214767	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	15055445		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart disease	Pubtator	30971721	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	30971721	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertrophic Cardiomyopathy	Hypertrophic cardiomyopathy	GWASDB_DG	23255317		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	16821082		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	27754994		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	16821082, 16948864, 27754994		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	31632984		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	33845140	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	Pubtator	16948864	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	Pubtator	36318984	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of lung	Lung carcinoma	BEFREE	31632984		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	27754994		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	31364749		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ventricular Remodeling	Ventricular remodeling	Pubtator	30971721	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

RGS3 (regulator of G protein signaling 3)