Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	5997
Gene name	Regulator of G protein signaling 2
Gene symbol	RGS2
Synonyms (NCBI Gene)	G0S8
Chromosome	1
Chromosome location	1q31.2
Summary	Regulator of G protein signaling (RGS) family members are regulatory molecules that act as GTPase activating proteins (GAPs) for G alpha subunits of heterotrimeric G proteins. RGS proteins are able to deactivate G protein subunits of the Gi alpha, Go alph

Show/Hide all (1)

SNP ID	Visualize variation	Clinical significance	Consequence
rs547204431	G>C,T	Likely-pathogenic	Splice donor variant

114

Show/Hide all (114)

miRTarBase ID	miRNA	Experiments	Reference
MIRT005903	hsa-miR-22-3p	Luciferase reporter assayMicroarray	21168126
MIRT005903	hsa-miR-22-3p	Luciferase reporter assay	23349832
MIRT1304335	hsa-miR-128	CLIP-seq
MIRT1304336	hsa-miR-3126-5p	CLIP-seq
MIRT1304337	hsa-miR-3140-3p	CLIP-seq
MIRT1304338	hsa-miR-3619-3p	CLIP-seq
MIRT1304339	hsa-miR-4272	CLIP-seq
MIRT1304340	hsa-miR-4419a	CLIP-seq
MIRT1304341	hsa-miR-4477a	CLIP-seq
MIRT1304342	hsa-miR-4510	CLIP-seq
MIRT1304343	hsa-miR-4520b-3p	CLIP-seq
MIRT1304344	hsa-miR-4529-3p	CLIP-seq
MIRT1304345	hsa-miR-4535	CLIP-seq
MIRT1304346	hsa-miR-4672	CLIP-seq
MIRT1304347	hsa-miR-4776-5p	CLIP-seq
MIRT1304348	hsa-miR-548l	CLIP-seq
MIRT1304349	hsa-miR-548n	CLIP-seq
MIRT1304350	hsa-miR-548t	CLIP-seq
MIRT2314912	hsa-miR-1200	CLIP-seq
MIRT2314913	hsa-miR-1207-5p	CLIP-seq
MIRT2314914	hsa-miR-1271	CLIP-seq
MIRT1304335	hsa-miR-128	CLIP-seq
MIRT2314915	hsa-miR-182	CLIP-seq
MIRT2314916	hsa-miR-191	CLIP-seq
MIRT2314917	hsa-miR-193a-3p	CLIP-seq
MIRT2314918	hsa-miR-193b	CLIP-seq
MIRT2314919	hsa-miR-223	CLIP-seq
MIRT2314920	hsa-miR-4279	CLIP-seq
MIRT2314921	hsa-miR-4736	CLIP-seq
MIRT2314922	hsa-miR-4763-3p	CLIP-seq
MIRT2314923	hsa-miR-516a-3p	CLIP-seq
MIRT2314924	hsa-miR-634	CLIP-seq
MIRT2314925	hsa-miR-892b	CLIP-seq
MIRT2314926	hsa-miR-935	CLIP-seq
MIRT2314927	hsa-miR-96	CLIP-seq
MIRT2439900	hsa-miR-377	CLIP-seq
MIRT2442553	hsa-miR-101	CLIP-seq
MIRT2442554	hsa-miR-1278	CLIP-seq
MIRT2442555	hsa-miR-3682-3p	CLIP-seq
MIRT2442556	hsa-miR-4502	CLIP-seq
MIRT2442557	hsa-miR-4709-5p	CLIP-seq
MIRT2442553	hsa-miR-101	CLIP-seq
MIRT2611219	hsa-miR-1179	CLIP-seq
MIRT2314912	hsa-miR-1200	CLIP-seq
MIRT2442554	hsa-miR-1278	CLIP-seq
MIRT2314917	hsa-miR-193a-3p	CLIP-seq
MIRT2314918	hsa-miR-193b	CLIP-seq
MIRT2314919	hsa-miR-223	CLIP-seq
MIRT2611220	hsa-miR-3074-5p	CLIP-seq
MIRT2611221	hsa-miR-3140-5p	CLIP-seq
MIRT2611222	hsa-miR-3168	CLIP-seq
MIRT1304338	hsa-miR-3619-3p	CLIP-seq
MIRT2442555	hsa-miR-3682-3p	CLIP-seq
MIRT2439900	hsa-miR-377	CLIP-seq
MIRT2611223	hsa-miR-3929	CLIP-seq
MIRT2611224	hsa-miR-3974	CLIP-seq
MIRT2314920	hsa-miR-4279	CLIP-seq
MIRT2611225	hsa-miR-4303	CLIP-seq
MIRT2611226	hsa-miR-4419b	CLIP-seq
MIRT2611227	hsa-miR-4452	CLIP-seq
MIRT2611228	hsa-miR-4478	CLIP-seq
MIRT2442556	hsa-miR-4502	CLIP-seq
MIRT2611229	hsa-miR-4511	CLIP-seq
MIRT2611230	hsa-miR-4666-5p	CLIP-seq
MIRT2611231	hsa-miR-4680-3p	CLIP-seq
MIRT2611232	hsa-miR-4682	CLIP-seq
MIRT2442557	hsa-miR-4709-5p	CLIP-seq
MIRT2611233	hsa-miR-4761-5p	CLIP-seq
MIRT2611234	hsa-miR-4765	CLIP-seq
MIRT2314923	hsa-miR-516a-3p	CLIP-seq
MIRT2611235	hsa-miR-548b-3p	CLIP-seq
MIRT2611236	hsa-miR-622	CLIP-seq
MIRT2314924	hsa-miR-634	CLIP-seq
MIRT2314925	hsa-miR-892b	CLIP-seq
MIRT2314926	hsa-miR-935	CLIP-seq
MIRT2442553	hsa-miR-101	CLIP-seq
MIRT2611219	hsa-miR-1179	CLIP-seq
MIRT2442554	hsa-miR-1278	CLIP-seq
MIRT2689726	hsa-miR-144	CLIP-seq
MIRT2314917	hsa-miR-193a-3p	CLIP-seq
MIRT2314918	hsa-miR-193b	CLIP-seq
MIRT2314919	hsa-miR-223	CLIP-seq
MIRT2689727	hsa-miR-2909	CLIP-seq
MIRT2689728	hsa-miR-299-3p	CLIP-seq
MIRT1304337	hsa-miR-3140-3p	CLIP-seq
MIRT2689729	hsa-miR-3153	CLIP-seq
MIRT2689730	hsa-miR-3162-5p	CLIP-seq
MIRT1304338	hsa-miR-3619-3p	CLIP-seq
MIRT2442555	hsa-miR-3682-3p	CLIP-seq
MIRT2439900	hsa-miR-377	CLIP-seq
MIRT2314920	hsa-miR-4279	CLIP-seq
MIRT2689731	hsa-miR-4491	CLIP-seq
MIRT2442556	hsa-miR-4502	CLIP-seq
MIRT2611229	hsa-miR-4511	CLIP-seq
MIRT1304343	hsa-miR-4520b-3p	CLIP-seq
MIRT1304344	hsa-miR-4529-3p	CLIP-seq
MIRT1304345	hsa-miR-4535	CLIP-seq
MIRT2689732	hsa-miR-4536	CLIP-seq
MIRT2689733	hsa-miR-4657	CLIP-seq
MIRT2611230	hsa-miR-4666-5p	CLIP-seq
MIRT2442557	hsa-miR-4709-5p	CLIP-seq
MIRT2689734	hsa-miR-4753-5p	CLIP-seq
MIRT1304347	hsa-miR-4776-5p	CLIP-seq
MIRT2689735	hsa-miR-4802-3p	CLIP-seq
MIRT2689736	hsa-miR-490-5p	CLIP-seq
MIRT2689737	hsa-miR-548a-3p	CLIP-seq
MIRT2611235	hsa-miR-548b-3p	CLIP-seq
MIRT2689738	hsa-miR-548e	CLIP-seq
MIRT2689739	hsa-miR-548f	CLIP-seq
MIRT2689740	hsa-miR-593	CLIP-seq
MIRT2689741	hsa-miR-606	CLIP-seq
MIRT2314924	hsa-miR-634	CLIP-seq
MIRT2314925	hsa-miR-892b	CLIP-seq
MIRT2314926	hsa-miR-935	CLIP-seq

Show/Hide all (53)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001965	Function	G-protein alpha-subunit binding	IPI	19478087
GO:0001975	Process	Response to amphetamine	IEA
GO:0003924	Function	GTPase activity	IEA
GO:0003924	Function	GTPase activity	TAS
GO:0005096	Function	GTPase activator activity	IEA
GO:0005096	Function	GTPase activator activity	IMP	19478087
GO:0005096	Function	GTPase activator activity	TAS	10747990
GO:0005515	Function	Protein binding	IPI	14608379, 17464283, 23434405, 24794857, 25416956, 25766235, 25910212, 32296183, 32814053
GO:0005516	Function	Calmodulin binding	TAS	10747990
GO:0005634	Component	Nucleus	IDA	10791963, 11278586
GO:0005634	Component	Nucleus	IEA
GO:0005730	Component	Nucleolus	IEA
GO:0005737	Component	Cytoplasm	IDA	11278586
GO:0005737	Component	Cytoplasm	IEA
GO:0005739	Component	Mitochondrion	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	ISS
GO:0005886	Component	Plasma membrane	IDA	11278586
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0006417	Process	Regulation of translation	IEA
GO:0007186	Process	G protein-coupled receptor signaling pathway	TAS
GO:0007283	Process	Spermatogenesis	IEA
GO:0008277	Process	Regulation of G protein-coupled receptor signaling pathway	TAS	10747990
GO:0009898	Component	Cytoplasmic side of plasma membrane	IEA
GO:0009898	Component	Cytoplasmic side of plasma membrane	ISS
GO:0009968	Process	Negative regulation of signal transduction	IEA
GO:0010614	Process	Negative regulation of cardiac muscle hypertrophy	IEA
GO:0010614	Process	Negative regulation of cardiac muscle hypertrophy	ISS
GO:0010855	Function	Adenylate cyclase inhibitor activity	IEA
GO:0010976	Process	Positive regulation of neuron projection development	IEA
GO:0016020	Component	Membrane	IEA
GO:0017148	Process	Negative regulation of translation	IEA
GO:0045471	Process	Response to ethanol	IEA
GO:0045744	Process	Negative regulation of G protein-coupled receptor signaling pathway	IEA
GO:0045744	Process	Negative regulation of G protein-coupled receptor signaling pathway	ISS
GO:0046329	Process	Negative regulation of JNK cascade	IEA
GO:0046329	Process	Negative regulation of JNK cascade	ISS
GO:0048487	Function	Beta-tubulin binding	IEA
GO:0050873	Process	Brown fat cell differentiation	IEA
GO:0055119	Process	Relaxation of cardiac muscle	IEA
GO:0055119	Process	Relaxation of cardiac muscle	ISS
GO:0060087	Process	Relaxation of vascular associated smooth muscle	IEA
GO:0060135	Process	Maternal process involved in female pregnancy	IEA
GO:0060452	Process	Positive regulation of cardiac muscle contraction	IEA
GO:0060452	Process	Positive regulation of cardiac muscle contraction	ISS
GO:0061052	Process	Negative regulation of cell growth involved in cardiac muscle cell development	IEA
GO:0071877	Process	Regulation of adenylate cyclase-inhibiting adrenergic receptor signaling pathway	IEA
GO:0071877	Process	Regulation of adenylate cyclase-inhibiting adrenergic receptor signaling pathway	ISS
GO:1900738	Process	Positive regulation of phospholipase C-activating G protein-coupled receptor signaling pathway	IEA
GO:1900738	Process	Positive regulation of phospholipase C-activating G protein-coupled receptor signaling pathway	ISS
GO:1900924	Process	Negative regulation of glycine import across plasma membrane	IEA

MIM	HGNC	e!Ensembl
600861	9998	ENSG00000116741

P41220

Protein name

Regulator of G-protein signaling 2 (RGS2) (Cell growth-inhibiting gene 31 protein) (G0/G1 switch regulatory protein 8)

Protein function

Regulates G protein-coupled receptor signaling cascades. Inhibits signal transduction by increasing the GTPase activity of G protein alpha subunits, thereby driving them into their inactive GDP-bound form (PubMed:11063746, PubMed:19478087). It i

PDB

2AF0 , 2V4Z , 4EKC , 4EKD

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00615	RGS	83 → 198	Regulator of G protein signaling domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in acute myelogenous leukemia (AML) and in acute lymphoblastic leukemia (ALL). {ECO:0000269|PubMed:7643615}.

Sequence

MQSAMFLAVQHDCRPMDKSAGSGHKSEEKREKMKRTLLKDWKTRLSYFLQNSSTPGKPKT
GKKSKQQAFIKPSPEEAQLWSEAFDELLASKYGLAAFRAFLKSEFCEENIEFWLACEDFK
KTKSPQKLSSKARKIYTDFIEKEAPKEINIDFQTKTLIAQNIQEATSGCFTTAQKRVYSL
MENNSYPRFLESEFYQDLCKKPQITTEPHAT

Sequence length

211

Interactions

View interactions

	KEGG		Reactome
	cGMP-PKG signaling pathway Olfactory transduction Oxytocin signaling pathway		G alpha (q) signalling events

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (12)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
BREAST NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSIVE DISEASE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEUKEMIA, MYELOID, ACUTE	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARKINSON DISEASE, SECONDARY	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RGS2-related disorder	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SECONDARY PARKINSON DISEASE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STOMACH NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (98)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acute monocytic leukemia	Monocytic Leukemia	BEFREE	15536149		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Myeloid Leukemia (AML-M2)	Leukemia	CTD_human_DG	17330099		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Myeloid Leukemia, M1	Myeloid Leukemia	CTD_human_DG	17330099		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	27701409	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	BEFREE	16736243, 17728697, 18833580, 25740197, 25847876, 30103281, 30107643		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety disorder	Pubtator	18833580, 19162436, 20847599	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	16736243, 17728697, 18833580, 21438143, 25740197, 25847876, 30103281, 30107643		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	21451528		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	22704538, 25368964, 30305828		★★★★★ ★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	11755214, 26263491		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia Telangiectasia	BEFREE	20352235		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	21451528		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	39198660	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerotic Parkinsonism	Atherosclerotic Parkinsonism	CTD_human_DG	18347610		★★★★★ ★☆☆☆☆ Found in Text Mining only
Attention Deficit Disorder with Hyperactivity	Attention deficit hyperactivity disorder	Pubtator	33115496	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	15375002, 25323766		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	CTD_human_DG	16298037		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	25187114, 29391880		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	34849149, 36299824	Inhibit	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	37014700	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinoma	Carcinoma	BEFREE	30467386		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	40416605	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	15375002, 25323766		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	BEFREE	12176127		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	15268629, 27558088		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	27558088, 39198660	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carotid Atherosclerosis	Carotid Atherosclerosis	BEFREE	21451528		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Ischemic stroke	Pubtator	31168961, 40442227	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognition disorder	Pubtator	27701409	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	20001967		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	35924235	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	28641980		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Disease	Coronary artery disease	Pubtator	32743916	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	29944393		★★★★★ ★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	30103281, 30107643		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	24562335	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	24562335		★★★★★ ★☆☆☆☆ Found in Text Mining only
EAR, PATELLA, SHORT STATURE SYNDROME	Ear Diseases	BEFREE	18347610		★★★★★ ★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	BEFREE	20375904, 20662725, 25849301		★★★★★ ★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	Pubtator	20662725, 25849301	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Extrapyramidal Disorders	Extrapyramidal disease	BEFREE	19156702		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gitelman Syndrome	Gitelman Syndrome	BEFREE	15292363		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	28641980		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Diffuse Gastric Cancer	Gastric Cancer	CTD_human_DG	16367923		★★★★★ ★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	21779398, 23349832		★★★★★ ★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington disease	Pubtator	21779398	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	19478087, 20662725, 24593135, 27558088	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertensive disease	Hypertension	BEFREE	12588882, 15268629, 15292363, 16003176, 16432041, 17220356, 18230714, 18249218, 18496125, 19023274, 20662725, 21451528, 22057271, 23339167, 23859711 View all (6 more)		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertensive disease	Hypertension	CTD_human_DG	1798635		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypertensive disease	Hypertension	LHGDN	18230714		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hypocholesterolemia	Hypocholesterolemia	BEFREE	29074411		★★★★★ ★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	27549302		★★★★★ ★☆☆☆☆ Found in Text Mining only
Laryngeal Neoplasms	Laryngeal neoplasm	Pubtator	36033826	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	15536149	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	15536149		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	CTD_human_DG	17330099		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	CTD_human_DG	16298037		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	25187114, 29391880		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	21500190, 30467386		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	CTD_human_DG	16367923		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	29858600		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	15375002, 25323766		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	29391880		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malnutrition	Malnutrition	BEFREE	24973550		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Carcinoma, Human	Marfan Syndrome	CTD_human_DG	16298037		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	CTD_human_DG	16298037		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms, Human	Mammary Neoplasms	CTD_human_DG	16298037		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	30103281		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	17143182		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mild cognitive disorder	Cognitive disorder	BEFREE	27701409		★★★★★ ★☆☆☆☆ Found in Text Mining only
Movement Disorders	Movement Disorders	BEFREE	22615781		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	39198660	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	20001967, 21494556, 25187114, 30467386		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	11322774		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	17143182, 27558088		★★★★★ ★☆☆☆☆ Found in Text Mining only
Panic Disorder	Panic Disorder	BEFREE	18833580, 21438143, 25740197, 26575296		★★★★★ ★☆☆☆☆ Found in Text Mining only
Panic Disorder	Panic disorder	Pubtator	18833580, 20847599	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	24794857		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinson Disease, Secondary Vascular	Parkinson Disease	CTD_human_DG	18347610		★★★★★ ★☆☆☆☆ Found in Text Mining only
Parkinsonian Disorders	Parkinson Disease	BEFREE	17558307, 18347610, 19156702, 19931593, 22615781		★★★★★ ★☆☆☆☆ Found in Text Mining only
Post-Traumatic Stress Disorder	Stress Disorder	BEFREE	19162436		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	21500190, 30467386		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	16449965		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	27549302		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal fibrosis	Renal fibrosis	BEFREE	24973550		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	18262772, 19931593		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	LHGDN	18262772		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	PSYGENET_DG	18262772, 19931593		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Seasonal Affective Disorder	Seasonal Affective Disorder	BEFREE	24154666		★★★★★ ★☆☆☆☆ Found in Text Mining only
Secondary Parkinson Disease	Parkinson disease	CTD_human_DG	18347610		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sepsis	Sepsis	Pubtator	34393665	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	20627871	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	34041882	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	29858600		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	CTD_human_DG	16367923		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stomach Neoplasms	Stomach neoplasms	Pubtator	38274323	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	25323766	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal melanoma	Pubtator	35452684	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only

RGS2 (regulator of G protein signaling 2)