Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	5983
Gene name	Replication factor C subunit 3
Gene symbol	RFC3
Synonyms (NCBI Gene)	RFC38
Chromosome	13
Chromosome location	13q13.2
Summary	The elongation of primed DNA templates by DNA polymerase delta and DNA polymerase epsilon requires the accessory proteins proliferating cell nuclear antigen (PCNA) and replication factor C (RFC). RFC, also named activator 1, is a protein complex consistin

Show/Hide all (66)

miRTarBase ID	miRNA	Experiments	Reference
MIRT022240	hsa-miR-124-3p	Proteomics;Microarray	18668037
MIRT050570	hsa-miR-20a-5p	CLASH	23622248
MIRT048816	hsa-miR-93-5p	CLASH	23622248
MIRT1301548	hsa-miR-1246	CLIP-seq
MIRT1301549	hsa-miR-1255a	CLIP-seq
MIRT1301550	hsa-miR-1255b	CLIP-seq
MIRT1301551	hsa-miR-1323	CLIP-seq
MIRT1301552	hsa-miR-181a	CLIP-seq
MIRT1301553	hsa-miR-181b	CLIP-seq
MIRT1301554	hsa-miR-181c	CLIP-seq
MIRT1301555	hsa-miR-181d	CLIP-seq
MIRT1301556	hsa-miR-28-5p	CLIP-seq
MIRT1301557	hsa-miR-3065-5p	CLIP-seq
MIRT1301558	hsa-miR-3139	CLIP-seq
MIRT1301559	hsa-miR-3170	CLIP-seq
MIRT1301560	hsa-miR-3201	CLIP-seq
MIRT1301561	hsa-miR-338-5p	CLIP-seq
MIRT1301562	hsa-miR-342-5p	CLIP-seq
MIRT1301563	hsa-miR-3545-3p	CLIP-seq
MIRT1301564	hsa-miR-3605-5p	CLIP-seq
MIRT1301565	hsa-miR-3606	CLIP-seq
MIRT1301566	hsa-miR-3660	CLIP-seq
MIRT1301567	hsa-miR-421	CLIP-seq
MIRT1301568	hsa-miR-4251	CLIP-seq
MIRT1301569	hsa-miR-4257	CLIP-seq
MIRT1301570	hsa-miR-4260	CLIP-seq
MIRT1301571	hsa-miR-4262	CLIP-seq
MIRT1301572	hsa-miR-4272	CLIP-seq
MIRT1301573	hsa-miR-4471	CLIP-seq
MIRT1301574	hsa-miR-450b-5p	CLIP-seq
MIRT1301575	hsa-miR-4526	CLIP-seq
MIRT1301576	hsa-miR-4651	CLIP-seq
MIRT1301577	hsa-miR-4664-5p	CLIP-seq
MIRT1301578	hsa-miR-4696	CLIP-seq
MIRT1301579	hsa-miR-4764-3p	CLIP-seq
MIRT1301580	hsa-miR-4791	CLIP-seq
MIRT1301581	hsa-miR-4802-5p	CLIP-seq
MIRT1301582	hsa-miR-494	CLIP-seq
MIRT1301583	hsa-miR-518a-5p	CLIP-seq
MIRT1301584	hsa-miR-527	CLIP-seq
MIRT1301585	hsa-miR-539	CLIP-seq
MIRT1301586	hsa-miR-543	CLIP-seq
MIRT1301587	hsa-miR-548o	CLIP-seq
MIRT1301588	hsa-miR-608	CLIP-seq
MIRT1301589	hsa-miR-633	CLIP-seq
MIRT1301590	hsa-miR-708	CLIP-seq
MIRT1301591	hsa-miR-944	CLIP-seq
MIRT1301552	hsa-miR-181a	CLIP-seq
MIRT1301553	hsa-miR-181b	CLIP-seq
MIRT1301554	hsa-miR-181c	CLIP-seq
MIRT1301555	hsa-miR-181d	CLIP-seq
MIRT1301592	hsa-miR-2113	CLIP-seq
MIRT1301593	hsa-miR-2467-3p	CLIP-seq
MIRT1301594	hsa-miR-3681	CLIP-seq
MIRT1301595	hsa-miR-3691-5p	CLIP-seq
MIRT1301571	hsa-miR-4262	CLIP-seq
MIRT1301596	hsa-miR-4436a	CLIP-seq
MIRT1301597	hsa-miR-4752	CLIP-seq
MIRT1301598	hsa-miR-4764-5p	CLIP-seq
MIRT1301599	hsa-miR-4796-3p	CLIP-seq
MIRT1301600	hsa-miR-520g	CLIP-seq
MIRT1301601	hsa-miR-520h	CLIP-seq
MIRT2089521	hsa-miR-4524	CLIP-seq
MIRT2089522	hsa-miR-4690-5p	CLIP-seq
MIRT1301598	hsa-miR-4764-5p	CLIP-seq
MIRT2314454	hsa-miR-151-3p	CLIP-seq

Show/Hide all (1)

Transcription factor	Regulation	Reference
AHR	Activation	12417031

Show/Hide all (29)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000731	Process	DNA synthesis involved in DNA repair	TAS	9488738
GO:0003677	Function	DNA binding	IDA	9488738
GO:0003677	Function	DNA binding	IEA
GO:0003689	Function	DNA clamp loader activity	IBA
GO:0003689	Function	DNA clamp loader activity	IDA	12930902
GO:0003689	Function	DNA clamp loader activity	TAS	9488738
GO:0005515	Function	Protein binding	IPI	9488738, 28514442, 32296183, 33961781
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005663	Component	DNA replication factor C complex	IBA
GO:0005663	Component	DNA replication factor C complex	IDA	9488738
GO:0005663	Component	DNA replication factor C complex	IPI	9488738
GO:0005663	Component	DNA replication factor C complex	TAS	7774928
GO:0005694	Component	Chromosome	IEA
GO:0006260	Process	DNA replication	IDA	9488738
GO:0006260	Process	DNA replication	IEA
GO:0006261	Process	DNA-templated DNA replication	IBA
GO:0006261	Process	DNA-templated DNA replication	IDA	9488738
GO:0006271	Process	DNA strand elongation involved in DNA replication	IEA
GO:0006271	Process	DNA strand elongation involved in DNA replication	TAS	7774928
GO:0006281	Process	DNA repair	IBA
GO:0006281	Process	DNA repair	IEA
GO:0008094	Function	ATP-dependent activity, acting on DNA	IDA	9488738
GO:0008094	Function	ATP-dependent activity, acting on DNA	IEA
GO:0017116	Function	Single-stranded DNA helicase activity	IDA	12930902
GO:0031390	Component	Ctf18 RFC-like complex	IDA	12930902
GO:0032991	Component	Protein-containing complex	IEA
GO:1900264	Process	Positive regulation of DNA-directed DNA polymerase activity	IDA	12930902

MIM	HGNC	e!Ensembl
600405	9971	ENSG00000133119

P40938

Protein name

Replication factor C subunit 3 (Activator 1 38 kDa subunit) (A1 38 kDa subunit) (Activator 1 subunit 3) (Replication factor C 38 kDa subunit) (RF-C 38 kDa subunit) (RFC38)

Protein function

Subunit of the replication factor C (RFC) complex which acts during elongation of primed DNA templates by DNA polymerases delta and epsilon, and is necessary for ATP-dependent loading of proliferating cell nuclear antigen (PCNA) onto primed DNA.

PDB

6VVO , 7Z6H , 8UI7 , 8UI8 , 8UI9 , 8UII , 8UMT , 8UMU , 8UMV , 8UMW , 8UMY , 8UN0 , 8UNJ

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF13177	DNA_pol3_delta2	18 → 188		Domain

Sequence

MSLWVDKYRPCSLGRLDYHKEQAAQLRNLVQCGDFPHLLVYGPSGAGKKTRIMCILRELY
GVGVEKLRIEHQTITTPSKKKIEISTIASNYHLEVNPSDAGNSDRVVIQEMLKTVAQSQQ
LETNSQRDFKVVLLTEVDKLTKDAQHALRRTMEKYMSTCRLILCCNSTSKVIPPIRSRCL
AVRVPAPSIEDICHVLSTVCKKEGLNLPSQLAHRLAEKSCRNLRKALLMCEACRVQQYPF
TADQEIPETDWEVYLRETANAIVSQQTPQRLLEVRGRLYELLTHCIPPEIIMKGLLSELL
HNCDGQLKGEVAQMAAYYEHRLQLGSKAIYHLEAFVAKFMALYKKFMEDGLEGMMF

Sequence length

356

Interactions

View interactions

	KEGG		Reactome
	DNA replication Base excision repair Nucleotide excision repair Mismatch repair		Translesion synthesis by REV1 Recognition of DNA damage by PCNA-containing replication complex Translesion Synthesis by POLH Polymerase switching on the C-strand of the telomere Activation of ATR in response to replication stress PCNA-Dependent Long Patch Base Excision Repair Translesion synthesis by POLK Translesion synthesis by POLI Termination of translesion DNA synthesis HDR through Single Strand Annealing (SSA) HDR through Homologous Recombination (HRR) Processing of DNA double-strand break ends Presynaptic phase of homologous DNA pairing and strand exchange Gap-filling DNA repair synthesis and ligation in GG-NER Dual Incision in GG-NER Dual incision in TC-NER Gap-filling DNA repair synthesis and ligation in TC-NER Regulation of TP53 Activity through Phosphorylation Polymerase switching G2/M DNA damage checkpoint

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (14)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ALZHEIMER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ASTROCYTOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CENTRAL NERVOUS SYSTEM CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL ADENOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEFICIENCY ANEMIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEUTROPENIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSYCHIATRIC DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PULMONARY FIBROSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RESPIRATORY TRACT INFECTIOUS DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCOLIOSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SQUAMOUS CELL LUNG CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VENOUS THROMBOEMBOLISM	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (33)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma Of Esophagus	Esophageal Cancer	BEFREE	22328562		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	31661124		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	34336000	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Barrett Esophagus	Barrett esophagus	BEFREE	22328562		★★★★★ ★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	Pubtator	22328562	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	22949521, 29593432		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	31311202, 38059884	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	31661124	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	26464638		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	20573375		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	33190424	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms Hereditary Nonpolyposis	Lynch syndrome	Pubtator	31297992	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Differentiated Thyroid Gland Carcinoma	Thyroid Carcinoma	BEFREE	27062014		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endocrine System Diseases	Endocrine system disease	Pubtator	38059884	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	31845510	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial cylindromatosis	Familial cylindromatosis	Pubtator	25351503	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial multiple trichoepitheliomata	Multiple Trichoepithelioma	BEFREE	22328562		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	25541153	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	25541153		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	26397132		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	31661124	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	22949521, 29593432		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	26464638		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	25213383		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	20573375, 22328562		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	40587682	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	26464638, 27888707		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Carcinoma	Ovarian Carcinoma	BEFREE	26464638		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	25030735	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	26464638	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	Pubtator	35483337	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	25213383		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	27888707		★★★★★ ★☆☆☆☆ Found in Text Mining only

RFC3 (replication factor C subunit 3)