Gene Gene information from NCBI Gene database.
Entrez ID 5965
Gene name RecQ like helicase
Gene symbol RECQL
Synonyms (NCBI Gene)
RECONRECQL1RecQ1
Chromosome 12
Chromosome location 12p12.1
Summary The protein encoded by this gene is a member of the RecQ DNA helicase family. DNA helicases are enzymes involved in various types of DNA repair, including mismatch repair, nucleotide excision repair and direct repair. The encoded protein is involved in th
SNPs SNP information provided by dbSNP.
15
SNP ID Visualize variation Clinical significance Consequence
rs376037221 A>C Likely-pathogenic Stop gained, coding sequence variant
rs572725483 G>A Likely-pathogenic Coding sequence variant, stop gained
rs745659712 T>-,TT Pathogenic Coding sequence variant, frameshift variant
rs753723230 A>- Likely-pathogenic, pathogenic Frameshift variant, coding sequence variant
rs768075076 ACAA>- Likely-pathogenic Coding sequence variant, frameshift variant
miRNA miRNA information provided by mirtarbase database.
105
miRTarBase ID miRNA Experiments Reference
MIRT024543 hsa-miR-215-5p Microarray 19074876
MIRT024543 hsa-miR-215-5p Microarray 19074876
MIRT026858 hsa-miR-192-5p Microarray 19074876
MIRT030018 hsa-miR-26b-5p Microarray 19088304
MIRT049712 hsa-miR-92a-3p CLASH 23622248
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
32
GO ID Ontology Definition Evidence Reference
GO:0000166 Function Nucleotide binding IEA
GO:0000724 Process Double-strand break repair via homologous recombination IBA
GO:0003676 Function Nucleic acid binding IEA
GO:0003677 Function DNA binding IEA
GO:0003678 Function DNA helicase activity IDA 11562355
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
600537 9948 ENSG00000004700
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
P46063
Protein name ATP-dependent DNA helicase Q1 (EC 5.6.2.4) (DNA 3'-5' helicase Q1) (DNA helicase, RecQ-like type 1) (RecQ1) (DNA-dependent ATPase Q1) (RecQ protein-like 1)
Protein function DNA helicase that plays a role in DNA damage repair and genome stability (PubMed:15886194, PubMed:35025765, PubMed:7527136, PubMed:7961977, PubMed:8056767). Exhibits a Mg(2+)- and ATP-dependent DNA-helicase activity that unwinds single- and doub
PDB 2V1X , 2WWY , 4U7D , 6JTZ , 8YRS
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF00270 DEAD 93 264 DEAD/DEAH box helicase Domain
PF00271 Helicase_C 299 409 Helicase conserved C-terminal domain Family
PF16124 RecQ_Zn_bind 420 479 RecQ zinc-binding Domain
Tissue specificity TISSUE SPECIFICITY: High expression in heart, lung, skeletal muscle and kidney, low expression in brain. {ECO:0000269|PubMed:7961977}.
Sequence
MASVSALTEELDSITSELHAVEIQIQELTERQQELIQKKKVLTKKIKQCLEDSDAGASNE
YDSSPAAWNKEDFPWSGKVKDILQNVFKLEKFRPLQLETINVTMAGKEVFLVMPTGGGKS
LCYQLPALCSDGFTLVICPLISLMEDQLMVLKQLGISATMLNASSSKEHVKWVHAEMVNK
NSELKLIYVTPEKIAKSKMFMSRLEKAYEARRFTRIAVDEVHCCSQWGHDFRPDYKALGI
LKRQFPNASLIGLTATATNHVLTD
AQKILCIEKCFTFTASFNRPNLYYEVRQKPSNTEDF
IEDIVKLINGRYKGQSGIIYCFSQKDSEQVTVSLQNLGIHAGAYHANLEPEDKTTVHRKW
SANEIQVVVATVAFGMGIDKPDVRFVIHHSMSKSMENYYQESGRAGRDD
MKADCILYYGF
GDIFRISSMVVMENVGQQKLYEMVSYCQNISKCRRVLMAQHFDEVWNSEACNKMCDNCC
K
DSAFERKNITEYCRDLIKILKQAEELNEKLTPLKLIDSWMGKGAAKLRVAGVVAPTLPRE
DLEKIIAHFLIQQYLKEDYSFTAYATISYLKIGPKANLLNNEAHAITMQVTKSTQNSFRA
ESSQTCHSEQGDKKMEEKNSGNFQKKAANMLQQSGSKNTGAKKRKIDDA
Sequence length 649
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
33
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession Evidence Score
Hereditary cancer-predisposing syndrome Likely pathogenic rs1565569139, rs1591973610, rs1591981379, rs1591981391, rs1591988737, rs756434860 RCV000709213
RCV000986144
RCV000986148
RCV000986149
RCV000986156
View all (1 more)
★★★★★
ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Malignant neoplastic disease Likely pathogenic rs1220859536 RCV002249152
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
Abnormal facial shape Uncertain significance ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Acute myeloid leukemia Benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
BREAST NEOPLASMS CTD
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Cervical cancer Uncertain significance; Benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Adenocarcinoma Adenocarcinoma BEFREE 23951333
★☆☆☆☆
Found in Text Mining only
Adenocarcinoma of pancreas Pancreatic adenocarcinoma BEFREE 19147782
★☆☆☆☆
Found in Text Mining only
Bloom Syndrome Bloom syndrome Pubtator 11154689, 11309417, 15899892, 16595695, 20826342, 23650516, 24958861, 30936263, 32221746 Associate
★☆☆☆☆
Found in Text Mining only
Breast Cancer, Familial Breast Cancer CLINGEN_DG 15886194, 17158923, 18074021, 25915596, 25945795
★☆☆☆☆
Found in Text Mining only
Breast Cancer, Familial Breast Cancer BEFREE 25945795, 31173646
★☆☆☆☆
Found in Text Mining only
Breast Carcinoma Breast Carcinoma BEFREE 25394896, 25483193, 25915596, 25945795, 26125302, 26455304, 27125668, 27832498, 27837030, 29100281, 29341116, 29351780, 29914420, 30610487, 31444271
★☆☆☆☆
Found in Text Mining only
Breast Carcinoma Breast Carcinoma CTD_human_DG 25915596
★☆☆☆☆
Found in Text Mining only
Breast Neoplasms Breast neoplasm Pubtator 25394896, 25483193, 25945795, 26125302, 26455304, 27248010, 27837030, 29351780, 29914420, 31444271, 32427313, 33468559, 34461861, 35231585, 35965009
View all (1 more)
Associate
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Carcinoma Intraductal Noninfiltrating Intraductal noninfiltrating carcinoma Pubtator 38134458 Associate
★☆☆☆☆
Found in Text Mining only
Carcinoma of larynx Laryngeal carcinoma BEFREE 24213927
★☆☆☆☆
Found in Text Mining only