CCND1 (cyclin D1)

Gene

• Entrez ID: 595
• Gene name: Cyclin D1
• Gene symbol: CCND1
• Synonyms (NCBI Gene): BCL1, D11S287E, PRAD1, U21B31
• Chromosome: 11
• Chromosome location: 11q13.3
• Summary: The protein encoded by this gene belongs to the highly conserved cyclin family, whose members are characterized by a dramatic periodicity in protein abundance throughout the cell cycle. Cyclins function as regulators of CDK kinases. Different cyclins exhi

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs9344	G>A	Risk-factor	Synonymous variant, coding sequence variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT001225	hsa-miR-16-5p	Western blot	18483394
MIRT001227	hsa-miR-15a-5p	qRT-PCR, Luciferase reporter assay, Western blot	19591824
MIRT001227	hsa-miR-15a-5p	qRT-PCR, Luciferase reporter assay, Western blot	19591824
MIRT001225	hsa-miR-16-5p	qRT-PCR, Luciferase reporter assay, Western blot	19591824
MIRT001225	hsa-miR-16-5p	qRT-PCR, Luciferase reporter assay, Western blot	19591824
MIRT001105	hsa-miR-503-5p	Luciferase reporter assay, qRT-PCR, Western blot	19538740
MIRT001013	hsa-miR-34a-5p	qRT-PCR, Luciferase reporter assay, Western blot	18406353
MIRT001013	hsa-miR-34a-5p	Luciferase reporter assay	18406353
MIRT000957	hsa-miR-16-1-3p	qRT-PCR, GFP reporter assay, Western blot	18483394
MIRT001225	hsa-miR-16-5p	qRT-PCR, flow, Western blot	18701644
MIRT001225	hsa-miR-16-5p	qRT-PCR, flow, Luciferase reporter assay, Western blot	18701644
MIRT000941	hsa-miR-424-5p	qRT-PCR, flow, Luciferase reporter assay, Western blot	18701644
MIRT000941	hsa-miR-424-5p	qRT-PCR, flow, Western blot	18701644
MIRT001225	hsa-miR-16-5p	qRT-PCR, flow, Western blot	18701644
MIRT000941	hsa-miR-424-5p	qRT-PCR, flow, Western blot	18701644
MIRT000941	hsa-miR-424-5p	qRT-PCR, flow, Luciferase reporter assay, Western blot	18701644
MIRT001225	hsa-miR-16-5p	qRT-PCR, flow, Luciferase reporter assay, Western blot	18701644
MIRT001013	hsa-miR-34a-5p	Review, Luciferase reporter assay	19461653
MIRT000941	hsa-miR-424-5p	Luciferase reporter assay	19956200
MIRT001105	hsa-miR-503-5p	Luciferase reporter assay	19956200
MIRT000480	hsa-miR-193b-3p	qRT-PCR, Luciferase reporter assay, Western blot, Microarray	20304954
MIRT001013	hsa-miR-34a-5p	qRT-PCR, Western blot	20309880
MIRT001227	hsa-miR-15a-5p	Luciferase reporter assay	19549910
MIRT001227	hsa-miR-15a-5p	Luciferase reporter assay	19549910
MIRT001227	hsa-miR-15a-5p	Luciferase reporter assay	19549910
MIRT001227	hsa-miR-15a-5p	Luciferase reporter assay	18931683
MIRT001225	hsa-miR-16-5p	Luciferase reporter assay	19549910
MIRT001225	hsa-miR-16-5p	Luciferase reporter assay	18701644
MIRT001225	hsa-miR-16-5p	Luciferase reporter assay	18483394
MIRT001225	hsa-miR-16-5p	Luciferase reporter assay	18931683
MIRT000480	hsa-miR-193b-3p	Luciferase reporter assay	20304954
MIRT003637	hsa-miR-302a-3p	Luciferase reporter assay, qRT-PCR, Western blot	18710938
MIRT003637	hsa-miR-302a-3p	Luciferase reporter assay, qRT-PCR, Western blot	18710938
MIRT003637	hsa-miR-302a-3p	Luciferase reporter assay, qRT-PCR, Western blot	18710938
MIRT003637	hsa-miR-302a-3p	Luciferase reporter assay, qRT-PCR, Western blot	18710938
MIRT001225	hsa-miR-16-5p	Review	20130964
MIRT003426	hsa-miR-19a-3p	flow, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	20133739
MIRT002484	hsa-let-7b-5p	immunoblot, Luciferase reporter assay, Northern blot, Western blot	20133835
MIRT004679	hsa-miR-449a	Flow, Immunoblot, Luciferase reporter assay	20948989
MIRT005287	hsa-miR-17-5p	Luciferase reporter assay, qRT-PCR, Western blot	18695042
MIRT000179	hsa-miR-20a-5p	Luciferase reporter assay, qRT-PCR, Western blot	18695042
MIRT003913	hsa-miR-15b-5p	qRT-PCR, Western blot	19135980
MIRT002484	hsa-let-7b-5p	Immunoblot, Immunofluorescence, Luciferase reporter assay, qRT-PCR	18379589
MIRT003637	hsa-miR-302a-3p	Luciferase reporter assay, Microarray, Northern blot, Western blot	21062975
MIRT003637	hsa-miR-302a-3p	Luciferase reporter assay, Microarray, Northern blot, Western blot	21062975
MIRT005671	hsa-miR-302c-3p	Luciferase reporter assay, Microarray, Northern blot, Western blot	21062975
MIRT005671	hsa-miR-302c-3p	Luciferase reporter assay, Microarray, Northern blot, Western blot	21062975
MIRT000480	hsa-miR-193b-3p	Luciferase reporter assay, qRT-PCR, Western blot	20655737
MIRT000480	hsa-miR-193b-3p	Luciferase reporter assay, qRT-PCR, Western blot	20655737
MIRT005287	hsa-miR-17-5p	Luciferase reporter assay	21283765
MIRT000179	hsa-miR-20a-5p	Luciferase reporter assay	21283765
MIRT005861	hsa-miR-106b-5p	Luciferase reporter assay	21283765
MIRT006122	hsa-let-7e-5p	Luciferase reporter assay, qRT-PCR, Western blot	21969366
MIRT006122	hsa-let-7e-5p	Luciferase reporter assay, qRT-PCR, Western blot	21969366
MIRT000225	hsa-miR-195-5p	Luciferase reporter assay, Western blot	22217655
MIRT000225	hsa-miR-195-5p	Luciferase reporter assay, Western blot	22217655
MIRT006242	hsa-miR-365a-3p	Luciferase reporter assay, Western blot	22072615
MIRT006276	hsa-miR-19b-1-5p	Western blot	22197821
MIRT006276	hsa-miR-19b-1-5p	Western blot	22197821
MIRT006283	hsa-miR-520b	Luciferase reporter assay	22319632
MIRT006283	hsa-miR-520b	Luciferase reporter assay	22319632
MIRT006290	hsa-miR-34b-3p	Luciferase reporter assay, qRT-PCR, Western blot	22113133
MIRT006122	hsa-let-7e-5p	Luciferase reporter assay, qRT-PCR, Western blot	21969366
MIRT006122	hsa-let-7e-5p	Luciferase reporter assay, qRT-PCR, Western blot	21969366
MIRT000225	hsa-miR-195-5p	Luciferase reporter assay, Western blot	22217655
MIRT000225	hsa-miR-195-5p	Luciferase reporter assay, Western blot	22217655
MIRT006242	hsa-miR-365a-3p	Luciferase reporter assay, Western blot	22072615
MIRT006276	hsa-miR-19b-1-5p	Western blot	22197821
MIRT006276	hsa-miR-19b-1-5p	Western blot	22197821
MIRT006283	hsa-miR-520b	Luciferase reporter assay	22319632
MIRT006283	hsa-miR-520b	Luciferase reporter assay	22319632
MIRT006290	hsa-miR-34b-3p	Luciferase reporter assay, qRT-PCR, Western blot	22113133
MIRT006122	hsa-let-7e-5p	Luciferase reporter assay, qRT-PCR, Western blot	21969366
MIRT006122	hsa-let-7e-5p	Luciferase reporter assay, qRT-PCR, Western blot	21969366
MIRT000225	hsa-miR-195-5p	Luciferase reporter assay, Western blot	22217655
MIRT000225	hsa-miR-195-5p	Luciferase reporter assay, Western blot	22217655
MIRT006242	hsa-miR-365a-3p	Luciferase reporter assay, Western blot	22072615
MIRT006276	hsa-miR-19b-1-5p	Western blot	22197821
MIRT006276	hsa-miR-19b-1-5p	Western blot	22197821
MIRT006283	hsa-miR-520b	Luciferase reporter assay	22319632
MIRT006283	hsa-miR-520b	Luciferase reporter assay	22319632
MIRT006290	hsa-miR-34b-3p	Luciferase reporter assay, qRT-PCR, Western blot	22113133
MIRT006822	hsa-miR-338-3p	Luciferase reporter assay	22942717
MIRT006822	hsa-miR-338-3p	Luciferase reporter assay	22912826
MIRT000225	hsa-miR-195-5p	Luciferase reporter assay	23383003
MIRT007372	hsa-miR-9-5p	Luciferase reporter assay	23383271
MIRT016061	hsa-miR-374b-5p	Sequencing	20371350
MIRT000480	hsa-miR-193b-3p	Reporter assay;Western blot;qRT-PCR;Microarray;Other	20304954
MIRT016658	hsa-miR-425-5p	Sequencing	20371350
MIRT020946	hsa-miR-155-5p	Proteomics	18668040
MIRT023800	hsa-miR-1-3p	Microarray	18668037
MIRT024995	hsa-miR-183-5p	Sequencing	20371350
MIRT001013	hsa-miR-34a-5p	Sequencing	20371350
MIRT001013	hsa-miR-34a-5p	Other	21399894
MIRT001013	hsa-miR-34a-5p	Reporter assay	18406353
MIRT028002	hsa-miR-93-5p	Sequencing	20371350
MIRT029483	hsa-miR-26b-5p	Microarray	19088304
MIRT032092	hsa-let-7f-5p	qRT-PCR	19956384
MIRT002484	hsa-let-7b-5p	Reporter assay;Other	18379589
MIRT001227	hsa-miR-15a-5p	CLASH	23622248
MIRT049839	hsa-miR-92a-3p	CLASH	23622248
MIRT048256	hsa-miR-196a-5p	CLASH	23622248
MIRT000480	hsa-miR-193b-3p	CLASH	23622248
MIRT000480	hsa-miR-193b-3p	CLASH	23622248
MIRT053080	hsa-miR-138-5p	Immunohistochemistry, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	22739938
MIRT000179	hsa-miR-20a-5p	qRT-PCR, Western blot	23836497
MIRT053230	hsa-miR-106a-5p	qRT-PCR, Western blot	23836497
MIRT000225	hsa-miR-195-5p	Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	23451060
MIRT001105	hsa-miR-503-5p	Immunohistochemistry, Luciferase reporter assay, Northern blot, qRT-PCR, Western blot	23731275
MIRT001105	hsa-miR-503-5p	Immunohistochemistry, Luciferase reporter assay, Northern blot, qRT-PCR, Western blot	23731275
MIRT001105	hsa-miR-503-5p	Immunohistochemistry, Luciferase reporter assay, Northern blot, qRT-PCR, Western blot	23731275
MIRT001105	hsa-miR-503-5p	Immunohistochemistry, Luciferase reporter assay, Northern blot, qRT-PCR, Western blot	23731275
MIRT053476	hsa-miR-27a-3p	Luciferase reporter assay, qRT-PCR, Western blot	21569481
MIRT006242	hsa-miR-365a-3p	Flow, In situ hybridization, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	24149576
MIRT004679	hsa-miR-449a	Flow, Luciferase reporter assay, qRT-PCR, Western blot	24248414
MIRT002484	hsa-let-7b-5p	Immunoblot, Microarray, qRT-PCR, Western blot, Annexin V-FITC	23806108
MIRT054359	hsa-miR-383-5p	Immunofluorescence, Immunohistochemistry, In situ hybridization, Luciferase reporter assay, Microarray, QRTPCR, Western blot	23640459
MIRT020946	hsa-miR-155-5p	Luciferase reporter assay, Western blot	22858023
MIRT020946	hsa-miR-155-5p	Luciferase reporter assay, Western blot	22858023
0	hsa-miR-454-3p	Luciferase reporter assay, qRT-PCR, Western blot	24505359
MIRT032092	hsa-let-7f-5p	Luciferase reporter assay	22894925
MIRT006242	hsa-miR-365a-3p	Luciferase reporter assay, Western blot	24936138
MIRT054840	hsa-miR-490-3p	Luciferase reporter assay, qRT-PCR, Western blot	24440705
MIRT054910	hsa-miR-603	Immunoblot, Luciferase reporter assay, qRT-PCR	23384558
MIRT054910	hsa-miR-603	Immunoblot, Luciferase reporter assay, qRT-PCR	23384558
MIRT437387	hsa-miR-708-5p	Flow, qRT-PCR, Western blot	23754151
MIRT006122	hsa-let-7e-5p	qRT-PCR, Western blot	24100610
MIRT003913	hsa-miR-15b-5p	Luciferase reporter assay, QRTPCR, Western blot	24995320
MIRT054359	hsa-miR-383-5p	Luciferase reporter assay	25450356
MIRT438439	hsa-miR-206	Luciferase reporter assay	24107628
MIRT001225	hsa-miR-16-5p	Western blot	24148817
MIRT438439	hsa-miR-206	Luciferase reporter assay, Western blot	25111862
MIRT438439	hsa-miR-206	Luciferase reporter assay, Western blot	25111862
MIRT438439	hsa-miR-206	Luciferase reporter assay, Western blot	25111862
MIRT016658	hsa-miR-425-5p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	23174883
MIRT438428	hsa-miR-152-3p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	23174883
MIRT438427	hsa-miR-24-3p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	23174883
MIRT438346	hsa-miR-29a-3p	qRT-PCR, Western blot	25889078
MIRT023800	hsa-miR-1-3p	qRT-PCR	25047835
MIRT000225	hsa-miR-195-5p	Luciferase reporter assay, qRT-PCR, Western blot	24402230
MIRT000225	hsa-miR-195-5p	Luciferase reporter assay, qRT-PCR, Western blot	24402230
MIRT438439	hsa-miR-206	Luciferase reporter assay	24107628
MIRT001225	hsa-miR-16-5p	Western blot	24148817
MIRT438439	hsa-miR-206	Luciferase reporter assay, Western blot	25111862
MIRT438439	hsa-miR-206	Luciferase reporter assay, Western blot	25111862
MIRT438439	hsa-miR-206	Luciferase reporter assay, Western blot	25111862
MIRT016658	hsa-miR-425-5p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	23174883
MIRT438428	hsa-miR-152-3p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	23174883
MIRT438427	hsa-miR-24-3p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	23174883
MIRT438346	hsa-miR-29a-3p	qRT-PCR, Western blot	25889078
MIRT023800	hsa-miR-1-3p	qRT-PCR	25047835
MIRT000225	hsa-miR-195-5p	Luciferase reporter assay, qRT-PCR, Western blot	24402230
MIRT000225	hsa-miR-195-5p	Luciferase reporter assay, qRT-PCR, Western blot	24402230
MIRT268282	hsa-miR-519d-3p	HITS-CLIP	21572407
MIRT005287	hsa-miR-17-5p	HITS-CLIP	21572407
MIRT268274	hsa-miR-20b-5p	HITS-CLIP	21572407
MIRT268279	hsa-miR-526b-3p	HITS-CLIP	21572407
MIRT028002	hsa-miR-93-5p	HITS-CLIP	21572407
MIRT053230	hsa-miR-106a-5p	HITS-CLIP	21572407
MIRT005861	hsa-miR-106b-5p	HITS-CLIP	21572407
MIRT000179	hsa-miR-20a-5p	HITS-CLIP	21572407
MIRT060553	hsa-miR-142-5p	HITS-CLIP	21572407
MIRT060561	hsa-miR-5590-3p	HITS-CLIP	21572407
MIRT060558	hsa-miR-3609	HITS-CLIP	21572407
MIRT060559	hsa-miR-548ah-5p	HITS-CLIP	21572407
MIRT479801	hsa-miR-4796-3p	HITS-CLIP	21572407
MIRT479800	hsa-miR-556-5p	HITS-CLIP	21572407
MIRT060555	hsa-miR-340-5p	HITS-CLIP	21572407
MIRT060556	hsa-miR-448	HITS-CLIP	21572407
MIRT502984	hsa-miR-944	HITS-CLIP	21572407
MIRT054910	hsa-miR-603	HITS-CLIP	21572407
MIRT502983	hsa-miR-369-3p	HITS-CLIP	21572407
MIRT502982	hsa-miR-5692b	HITS-CLIP	21572407
MIRT502981	hsa-miR-5692c	HITS-CLIP	21572407
MIRT268292	hsa-miR-216b-3p	HITS-CLIP	21572407
MIRT268294	hsa-miR-6500-3p	HITS-CLIP	21572407
MIRT502980	hsa-miR-891b	HITS-CLIP	21572407
MIRT241527	hsa-miR-374a-5p	HITS-CLIP	21572407
MIRT016061	hsa-miR-374b-5p	HITS-CLIP	21572407
MIRT268291	hsa-miR-491-3p	HITS-CLIP	21572407
MIRT704892	hsa-miR-3922-5p	HITS-CLIP	23313552
MIRT704891	hsa-miR-6884-3p	HITS-CLIP	23313552
MIRT704890	hsa-miR-1915-5p	HITS-CLIP	23313552
MIRT704889	hsa-miR-5699-5p	HITS-CLIP	23313552
MIRT704888	hsa-miR-4758-3p	HITS-CLIP	23313552
MIRT704887	hsa-miR-3189-5p	HITS-CLIP	23313552
MIRT268282	hsa-miR-519d-3p	PAR-CLIP	20371350
MIRT005287	hsa-miR-17-5p	PAR-CLIP	20371350
MIRT268274	hsa-miR-20b-5p	PAR-CLIP	20371350
MIRT268279	hsa-miR-526b-3p	PAR-CLIP	20371350
MIRT028002	hsa-miR-93-5p	PAR-CLIP	20371350
MIRT053230	hsa-miR-106a-5p	PAR-CLIP	20371350
MIRT005861	hsa-miR-106b-5p	PAR-CLIP	20371350
MIRT000179	hsa-miR-20a-5p	PAR-CLIP	20371350
MIRT060553	hsa-miR-142-5p	PAR-CLIP	20371350
MIRT060561	hsa-miR-5590-3p	PAR-CLIP	20371350
MIRT060558	hsa-miR-3609	PAR-CLIP	20371350
MIRT060559	hsa-miR-548ah-5p	PAR-CLIP	20371350
MIRT479801	hsa-miR-4796-3p	PAR-CLIP	20371350
MIRT479800	hsa-miR-556-5p	PAR-CLIP	20371350
MIRT060555	hsa-miR-340-5p	PAR-CLIP	20371350
MIRT060556	hsa-miR-448	PAR-CLIP	20371350
MIRT334170	hsa-miR-4781-3p	PAR-CLIP	20371350
MIRT334166	hsa-miR-494-3p	PAR-CLIP	20371350
MIRT479735	hsa-miR-7706	PAR-CLIP	20371350
MIRT512169	hsa-miR-3648	PAR-CLIP	20371350
MIRT512168	hsa-miR-4746-3p	PAR-CLIP	20371350
MIRT479734	hsa-miR-4731-5p	PAR-CLIP	20371350
MIRT479733	hsa-miR-5589-5p	PAR-CLIP	20371350
MIRT334167	hsa-miR-4261	PAR-CLIP	20371350
MIRT479732	hsa-miR-4747-5p	PAR-CLIP	20371350
MIRT479731	hsa-miR-5196-5p	PAR-CLIP	20371350
MIRT479730	hsa-miR-3907	PAR-CLIP	20371350
MIRT334169	hsa-miR-4666a-5p	PAR-CLIP	20371350
MIRT268282	hsa-miR-519d-3p	PAR-CLIP	20371350
MIRT005287	hsa-miR-17-5p	PAR-CLIP	20371350
MIRT268274	hsa-miR-20b-5p	PAR-CLIP	20371350
MIRT268279	hsa-miR-526b-3p	PAR-CLIP	20371350
MIRT028002	hsa-miR-93-5p	PAR-CLIP	20371350
MIRT053230	hsa-miR-106a-5p	PAR-CLIP	20371350
MIRT005861	hsa-miR-106b-5p	PAR-CLIP	20371350
MIRT000179	hsa-miR-20a-5p	PAR-CLIP	20371350
MIRT060553	hsa-miR-142-5p	PAR-CLIP	20371350
MIRT060561	hsa-miR-5590-3p	PAR-CLIP	20371350
MIRT060558	hsa-miR-3609	PAR-CLIP	20371350
MIRT060559	hsa-miR-548ah-5p	PAR-CLIP	20371350
MIRT479801	hsa-miR-4796-3p	PAR-CLIP	20371350
MIRT479800	hsa-miR-556-5p	PAR-CLIP	20371350
MIRT060555	hsa-miR-340-5p	PAR-CLIP	20371350
MIRT060556	hsa-miR-448	PAR-CLIP	20371350
MIRT001105	hsa-miR-503-5p	PAR-CLIP	20371350
MIRT060574	hsa-miR-4694-3p	PAR-CLIP	20371350
MIRT060571	hsa-miR-558	PAR-CLIP	20371350
MIRT479775	hsa-miR-4633-3p	PAR-CLIP	20371350
MIRT479774	hsa-miR-6500-5p	PAR-CLIP	20371350
MIRT479773	hsa-miR-95-3p	PAR-CLIP	20371350
MIRT060579	hsa-miR-6874-5p	PAR-CLIP	20371350
MIRT001105	hsa-miR-503-5p	PAR-CLIP	20371350
MIRT060574	hsa-miR-4694-3p	PAR-CLIP	20371350
MIRT060571	hsa-miR-558	PAR-CLIP	20371350
MIRT479775	hsa-miR-4633-3p	PAR-CLIP	20371350
MIRT479774	hsa-miR-6500-5p	PAR-CLIP	20371350
MIRT479773	hsa-miR-95-3p	PAR-CLIP	20371350
MIRT060579	hsa-miR-6874-5p	PAR-CLIP	20371350
MIRT334170	hsa-miR-4781-3p	PAR-CLIP	20371350
MIRT334165	hsa-miR-204-3p	PAR-CLIP	20371350
MIRT334168	hsa-miR-4646-5p	PAR-CLIP	20371350
MIRT479735	hsa-miR-7706	PAR-CLIP	20371350
MIRT512169	hsa-miR-3648	PAR-CLIP	20371350
MIRT512168	hsa-miR-4746-3p	PAR-CLIP	20371350
MIRT479734	hsa-miR-4731-5p	PAR-CLIP	20371350
MIRT479733	hsa-miR-5589-5p	PAR-CLIP	20371350
MIRT334167	hsa-miR-4261	PAR-CLIP	20371350
MIRT479732	hsa-miR-4747-5p	PAR-CLIP	20371350
MIRT479731	hsa-miR-5196-5p	PAR-CLIP	20371350
MIRT479730	hsa-miR-3907	PAR-CLIP	20371350
MIRT334169	hsa-miR-4666a-5p	PAR-CLIP	20371350
MIRT268282	hsa-miR-519d-3p	PAR-CLIP	20371350
MIRT005287	hsa-miR-17-5p	PAR-CLIP	20371350
MIRT268274	hsa-miR-20b-5p	PAR-CLIP	20371350
MIRT268279	hsa-miR-526b-3p	PAR-CLIP	20371350
MIRT028002	hsa-miR-93-5p	PAR-CLIP	20371350
MIRT053230	hsa-miR-106a-5p	PAR-CLIP	20371350
MIRT005861	hsa-miR-106b-5p	PAR-CLIP	20371350
MIRT000179	hsa-miR-20a-5p	PAR-CLIP	20371350
MIRT060553	hsa-miR-142-5p	PAR-CLIP	20371350
MIRT060561	hsa-miR-5590-3p	PAR-CLIP	20371350
MIRT060558	hsa-miR-3609	PAR-CLIP	20371350
MIRT060559	hsa-miR-548ah-5p	PAR-CLIP	20371350
MIRT479801	hsa-miR-4796-3p	PAR-CLIP	20371350
MIRT479800	hsa-miR-556-5p	PAR-CLIP	20371350
MIRT060555	hsa-miR-340-5p	PAR-CLIP	20371350
MIRT060556	hsa-miR-448	PAR-CLIP	20371350
MIRT001105	hsa-miR-503-5p	PAR-CLIP	20371350
MIRT060574	hsa-miR-4694-3p	PAR-CLIP	20371350
MIRT060571	hsa-miR-558	PAR-CLIP	20371350
MIRT479775	hsa-miR-4633-3p	PAR-CLIP	20371350
MIRT479774	hsa-miR-6500-5p	PAR-CLIP	20371350
MIRT479773	hsa-miR-95-3p	PAR-CLIP	20371350
MIRT060579	hsa-miR-6874-5p	PAR-CLIP	20371350
MIRT502984	hsa-miR-944	PAR-CLIP	20371350
MIRT502983	hsa-miR-369-3p	PAR-CLIP	20371350
MIRT502982	hsa-miR-5692b	PAR-CLIP	20371350
MIRT502981	hsa-miR-5692c	PAR-CLIP	20371350
MIRT268294	hsa-miR-6500-3p	PAR-CLIP	20371350
MIRT502980	hsa-miR-891b	PAR-CLIP	20371350
MIRT241527	hsa-miR-374a-5p	PAR-CLIP	20371350
MIRT016061	hsa-miR-374b-5p	PAR-CLIP	20371350
MIRT268291	hsa-miR-491-3p	PAR-CLIP	20371350
MIRT001105	hsa-miR-503-5p	PAR-CLIP	21572407
MIRT060574	hsa-miR-4694-3p	PAR-CLIP	21572407
MIRT060578	hsa-miR-6748-3p	PAR-CLIP	21572407
MIRT060572	hsa-miR-1234-3p	PAR-CLIP	21572407
MIRT060580	hsa-miR-7107-5p	PAR-CLIP	21572407
MIRT060571	hsa-miR-558	PAR-CLIP	21572407
MIRT060570	hsa-miR-214-5p	PAR-CLIP	21572407
MIRT060576	hsa-miR-1199-3p	PAR-CLIP	21572407
MIRT479775	hsa-miR-4633-3p	PAR-CLIP	21572407
MIRT479774	hsa-miR-6500-5p	PAR-CLIP	21572407
MIRT060577	hsa-miR-6735-3p	PAR-CLIP	21572407
MIRT479773	hsa-miR-95-3p	PAR-CLIP	21572407
MIRT060579	hsa-miR-6874-5p	PAR-CLIP	21572407
MIRT060553	hsa-miR-142-5p	PAR-CLIP	21572407
MIRT060561	hsa-miR-5590-3p	PAR-CLIP	21572407
MIRT060558	hsa-miR-3609	PAR-CLIP	21572407
MIRT060559	hsa-miR-548ah-5p	PAR-CLIP	21572407
MIRT479801	hsa-miR-4796-3p	PAR-CLIP	21572407
MIRT479800	hsa-miR-556-5p	PAR-CLIP	21572407
MIRT060555	hsa-miR-340-5p	PAR-CLIP	21572407
MIRT060556	hsa-miR-448	PAR-CLIP	21572407
MIRT549003	hsa-miR-18a-5p	PAR-CLIP	21572407
MIRT549002	hsa-miR-18b-5p	PAR-CLIP	21572407
MIRT549000	hsa-miR-4735-3p	PAR-CLIP	21572407
MIRT549001	hsa-miR-4789-3p	PAR-CLIP	21572407
MIRT548999	hsa-miR-4643	PAR-CLIP	21572407
MIRT111848	hsa-miR-4691-3p	PAR-CLIP	21572407
MIRT268267	hsa-miR-655-5p	PAR-CLIP	21572407
MIRT548998	hsa-miR-3941	PAR-CLIP	21572407
MIRT548997	hsa-miR-466	PAR-CLIP	21572407
MIRT111846	hsa-miR-3157-5p	PAR-CLIP	21572407
MIRT268268	hsa-miR-4709-3p	PAR-CLIP	21572407
MIRT001105	hsa-miR-503-5p	PAR-CLIP	21572407
MIRT060574	hsa-miR-4694-3p	PAR-CLIP	21572407
MIRT060571	hsa-miR-558	PAR-CLIP	21572407
MIRT479775	hsa-miR-4633-3p	PAR-CLIP	21572407
MIRT479774	hsa-miR-6500-5p	PAR-CLIP	21572407
MIRT479773	hsa-miR-95-3p	PAR-CLIP	21572407
MIRT060579	hsa-miR-6874-5p	PAR-CLIP	21572407
MIRT502984	hsa-miR-944	PAR-CLIP	21572407
MIRT054910	hsa-miR-603	PAR-CLIP	21572407
MIRT502983	hsa-miR-369-3p	PAR-CLIP	21572407
MIRT502982	hsa-miR-5692b	PAR-CLIP	21572407
MIRT502981	hsa-miR-5692c	PAR-CLIP	21572407
MIRT268292	hsa-miR-216b-3p	PAR-CLIP	21572407
MIRT268294	hsa-miR-6500-3p	PAR-CLIP	21572407
MIRT502980	hsa-miR-891b	PAR-CLIP	21572407
MIRT241527	hsa-miR-374a-5p	PAR-CLIP	21572407
MIRT016061	hsa-miR-374b-5p	PAR-CLIP	21572407
MIRT268291	hsa-miR-491-3p	PAR-CLIP	21572407
MIRT268282	hsa-miR-519d-3p	PAR-CLIP	21572407
MIRT005287	hsa-miR-17-5p	PAR-CLIP	21572407
MIRT268274	hsa-miR-20b-5p	PAR-CLIP	21572407
MIRT268279	hsa-miR-526b-3p	PAR-CLIP	21572407
MIRT028002	hsa-miR-93-5p	PAR-CLIP	21572407
MIRT053230	hsa-miR-106a-5p	PAR-CLIP	21572407
MIRT005861	hsa-miR-106b-5p	PAR-CLIP	21572407
MIRT000179	hsa-miR-20a-5p	PAR-CLIP	21572407
MIRT060553	hsa-miR-142-5p	PAR-CLIP	21572407
MIRT060561	hsa-miR-5590-3p	PAR-CLIP	21572407
MIRT060562	hsa-miR-548av-5p	PAR-CLIP	21572407
MIRT060557	hsa-miR-548k	PAR-CLIP	21572407
MIRT060563	hsa-miR-8054	PAR-CLIP	21572407
MIRT060558	hsa-miR-3609	PAR-CLIP	21572407
MIRT060559	hsa-miR-548ah-5p	PAR-CLIP	21572407
MIRT479801	hsa-miR-4796-3p	PAR-CLIP	21572407
MIRT541404	hsa-miR-4797-5p	PAR-CLIP	21572407
MIRT479800	hsa-miR-556-5p	PAR-CLIP	21572407
MIRT060560	hsa-miR-3973	PAR-CLIP	21572407
MIRT246924	hsa-miR-4756-3p	PAR-CLIP	21572407
MIRT246923	hsa-miR-4708-5p	PAR-CLIP	21572407
MIRT060555	hsa-miR-340-5p	PAR-CLIP	21572407
MIRT060556	hsa-miR-448	PAR-CLIP	21572407
MIRT268282	hsa-miR-519d-3p	PAR-CLIP	22012620
MIRT005287	hsa-miR-17-5p	PAR-CLIP	22012620
MIRT268274	hsa-miR-20b-5p	PAR-CLIP	22012620
MIRT268279	hsa-miR-526b-3p	PAR-CLIP	22012620
MIRT028002	hsa-miR-93-5p	PAR-CLIP	22012620
MIRT053230	hsa-miR-106a-5p	PAR-CLIP	22012620
MIRT005861	hsa-miR-106b-5p	PAR-CLIP	22012620
MIRT000179	hsa-miR-20a-5p	PAR-CLIP	22012620
MIRT060553	hsa-miR-142-5p	PAR-CLIP	22012620
MIRT060561	hsa-miR-5590-3p	PAR-CLIP	22012620
MIRT060558	hsa-miR-3609	PAR-CLIP	22012620
MIRT060559	hsa-miR-548ah-5p	PAR-CLIP	22012620
MIRT479801	hsa-miR-4796-3p	PAR-CLIP	22012620
MIRT479800	hsa-miR-556-5p	PAR-CLIP	22012620
MIRT060555	hsa-miR-340-5p	PAR-CLIP	22012620
MIRT060556	hsa-miR-448	PAR-CLIP	22012620
MIRT502984	hsa-miR-944	PAR-CLIP	22012620
MIRT054910	hsa-miR-603	PAR-CLIP	22012620
MIRT502983	hsa-miR-369-3p	PAR-CLIP	22012620
MIRT502982	hsa-miR-5692b	PAR-CLIP	22012620
MIRT502981	hsa-miR-5692c	PAR-CLIP	22012620
MIRT268292	hsa-miR-216b-3p	PAR-CLIP	22012620
MIRT268294	hsa-miR-6500-3p	PAR-CLIP	22012620
MIRT502980	hsa-miR-891b	PAR-CLIP	22012620
MIRT241527	hsa-miR-374a-5p	PAR-CLIP	22012620
MIRT016061	hsa-miR-374b-5p	PAR-CLIP	22012620
MIRT268291	hsa-miR-491-3p	PAR-CLIP	22012620
MIRT060553	hsa-miR-142-5p	PAR-CLIP	23446348
MIRT060561	hsa-miR-5590-3p	PAR-CLIP	23446348
MIRT060558	hsa-miR-3609	PAR-CLIP	23446348
MIRT060559	hsa-miR-548ah-5p	PAR-CLIP	23446348
MIRT479801	hsa-miR-4796-3p	PAR-CLIP	23446348
MIRT479800	hsa-miR-556-5p	PAR-CLIP	23446348
MIRT060555	hsa-miR-340-5p	PAR-CLIP	23446348
MIRT060556	hsa-miR-448	PAR-CLIP	23446348
MIRT502984	hsa-miR-944	PAR-CLIP	23446348
MIRT054910	hsa-miR-603	PAR-CLIP	23446348
MIRT502983	hsa-miR-369-3p	PAR-CLIP	23446348
MIRT502982	hsa-miR-5692b	PAR-CLIP	23446348
MIRT502981	hsa-miR-5692c	PAR-CLIP	23446348
MIRT268292	hsa-miR-216b-3p	PAR-CLIP	23446348
MIRT268294	hsa-miR-6500-3p	PAR-CLIP	23446348
MIRT502980	hsa-miR-891b	PAR-CLIP	23446348
MIRT241527	hsa-miR-374a-5p	PAR-CLIP	23446348
MIRT016061	hsa-miR-374b-5p	PAR-CLIP	23446348
MIRT268282	hsa-miR-519d-3p	PAR-CLIP	23446348
MIRT005287	hsa-miR-17-5p	PAR-CLIP	23446348
MIRT268274	hsa-miR-20b-5p	PAR-CLIP	23446348
MIRT268279	hsa-miR-526b-3p	PAR-CLIP	23446348
MIRT028002	hsa-miR-93-5p	PAR-CLIP	23446348
MIRT053230	hsa-miR-106a-5p	PAR-CLIP	23446348
MIRT005861	hsa-miR-106b-5p	PAR-CLIP	23446348
MIRT000179	hsa-miR-20a-5p	PAR-CLIP	23446348
MIRT060553	hsa-miR-142-5p	PAR-CLIP	23446348
MIRT060561	hsa-miR-5590-3p	PAR-CLIP	23446348
MIRT060558	hsa-miR-3609	PAR-CLIP	23446348
MIRT060559	hsa-miR-548ah-5p	PAR-CLIP	23446348
MIRT479801	hsa-miR-4796-3p	PAR-CLIP	23446348
MIRT479800	hsa-miR-556-5p	PAR-CLIP	23446348
MIRT060555	hsa-miR-340-5p	PAR-CLIP	23446348
MIRT060556	hsa-miR-448	PAR-CLIP	23446348
MIRT334170	hsa-miR-4781-3p	PAR-CLIP	23446348
MIRT512170	hsa-miR-875-3p	PAR-CLIP	23446348
MIRT334166	hsa-miR-494-3p	PAR-CLIP	23446348
MIRT479735	hsa-miR-7706	PAR-CLIP	23446348
MIRT512169	hsa-miR-3648	PAR-CLIP	23446348
MIRT512168	hsa-miR-4746-3p	PAR-CLIP	23446348
MIRT479734	hsa-miR-4731-5p	PAR-CLIP	23446348
MIRT479733	hsa-miR-5589-5p	PAR-CLIP	23446348
MIRT334167	hsa-miR-4261	PAR-CLIP	23446348
MIRT479732	hsa-miR-4747-5p	PAR-CLIP	23446348
MIRT479731	hsa-miR-5196-5p	PAR-CLIP	23446348
MIRT479730	hsa-miR-3907	PAR-CLIP	23446348
MIRT334169	hsa-miR-4666a-5p	PAR-CLIP	23446348
MIRT268282	hsa-miR-519d-3p	PAR-CLIP	24398324
MIRT005287	hsa-miR-17-5p	PAR-CLIP	24398324
MIRT268274	hsa-miR-20b-5p	PAR-CLIP	24398324
MIRT268279	hsa-miR-526b-3p	PAR-CLIP	24398324
MIRT028002	hsa-miR-93-5p	PAR-CLIP	24398324
MIRT053230	hsa-miR-106a-5p	PAR-CLIP	24398324
MIRT005861	hsa-miR-106b-5p	PAR-CLIP	24398324
MIRT000179	hsa-miR-20a-5p	PAR-CLIP	24398324
MIRT060553	hsa-miR-142-5p	PAR-CLIP	24398324
MIRT060561	hsa-miR-5590-3p	PAR-CLIP	24398324
MIRT060558	hsa-miR-3609	PAR-CLIP	24398324
MIRT060559	hsa-miR-548ah-5p	PAR-CLIP	24398324
MIRT479801	hsa-miR-4796-3p	PAR-CLIP	24398324
MIRT479800	hsa-miR-556-5p	PAR-CLIP	24398324
MIRT060555	hsa-miR-340-5p	PAR-CLIP	24398324
MIRT060556	hsa-miR-448	PAR-CLIP	24398324
MIRT001105	hsa-miR-503-5p	PAR-CLIP	24398324
MIRT060574	hsa-miR-4694-3p	PAR-CLIP	24398324
MIRT060578	hsa-miR-6748-3p	PAR-CLIP	24398324
MIRT060572	hsa-miR-1234-3p	PAR-CLIP	24398324
MIRT060580	hsa-miR-7107-5p	PAR-CLIP	24398324
MIRT060571	hsa-miR-558	PAR-CLIP	24398324
MIRT060570	hsa-miR-214-5p	PAR-CLIP	24398324
MIRT060576	hsa-miR-1199-3p	PAR-CLIP	24398324
MIRT479775	hsa-miR-4633-3p	PAR-CLIP	24398324
MIRT479774	hsa-miR-6500-5p	PAR-CLIP	24398324
MIRT060577	hsa-miR-6735-3p	PAR-CLIP	24398324
MIRT479773	hsa-miR-95-3p	PAR-CLIP	24398324
MIRT060579	hsa-miR-6874-5p	PAR-CLIP	24398324
MIRT060587	hsa-miR-6838-5p	PAR-CLIP	24398324
MIRT003913	hsa-miR-15b-5p	PAR-CLIP	24398324
MIRT000225	hsa-miR-195-5p	PAR-CLIP	24398324
MIRT000941	hsa-miR-424-5p	PAR-CLIP	24398324
MIRT001225	hsa-miR-16-5p	PAR-CLIP	24398324
MIRT060581	hsa-miR-497-5p	PAR-CLIP	24398324
MIRT001227	hsa-miR-15a-5p	PAR-CLIP	24398324
MIRT001105	hsa-miR-503-5p	PAR-CLIP	24398324
MIRT060584	hsa-miR-4311	PAR-CLIP	24398324
MIRT060588	hsa-miR-8066	PAR-CLIP	24398324
MIRT502988	hsa-miR-6768-5p	PAR-CLIP	24398324
MIRT502987	hsa-miR-646	PAR-CLIP	24398324
MIRT060583	hsa-miR-545-3p	PAR-CLIP	24398324
MIRT502986	hsa-miR-323b-3p	PAR-CLIP	24398324
MIRT502985	hsa-miR-1257	PAR-CLIP	24398324
MIRT060585	hsa-miR-4672	PAR-CLIP	24398324
MIRT060573	hsa-miR-4524a-5p	PAR-CLIP	24398324
MIRT060575	hsa-miR-4524b-5p	PAR-CLIP	24398324
MIRT246936	hsa-miR-4691-5p	PAR-CLIP	24398324
MIRT246937	hsa-miR-6792-3p	PAR-CLIP	24398324
MIRT502984	hsa-miR-944	PAR-CLIP	24398324
MIRT054910	hsa-miR-603	PAR-CLIP	24398324
MIRT502983	hsa-miR-369-3p	PAR-CLIP	24398324
MIRT502982	hsa-miR-5692b	PAR-CLIP	24398324
MIRT502981	hsa-miR-5692c	PAR-CLIP	24398324
MIRT268292	hsa-miR-216b-3p	PAR-CLIP	24398324
MIRT268294	hsa-miR-6500-3p	PAR-CLIP	24398324
MIRT502980	hsa-miR-891b	PAR-CLIP	24398324
MIRT241527	hsa-miR-374a-5p	PAR-CLIP	24398324
MIRT016061	hsa-miR-374b-5p	PAR-CLIP	24398324
MIRT268291	hsa-miR-491-3p	PAR-CLIP	24398324
MIRT268282	hsa-miR-519d-3p	PAR-CLIP	23592263
MIRT005287	hsa-miR-17-5p	PAR-CLIP	23592263
MIRT268274	hsa-miR-20b-5p	PAR-CLIP	23592263
MIRT268279	hsa-miR-526b-3p	PAR-CLIP	23592263
MIRT028002	hsa-miR-93-5p	PAR-CLIP	23592263
MIRT053230	hsa-miR-106a-5p	PAR-CLIP	23592263
MIRT005861	hsa-miR-106b-5p	PAR-CLIP	23592263
MIRT000179	hsa-miR-20a-5p	PAR-CLIP	23592263
MIRT060553	hsa-miR-142-5p	PAR-CLIP	23592263
MIRT060561	hsa-miR-5590-3p	PAR-CLIP	23592263
MIRT060558	hsa-miR-3609	PAR-CLIP	23592263
MIRT060559	hsa-miR-548ah-5p	PAR-CLIP	23592263
MIRT479801	hsa-miR-4796-3p	PAR-CLIP	23592263
MIRT479800	hsa-miR-556-5p	PAR-CLIP	23592263
MIRT060555	hsa-miR-340-5p	PAR-CLIP	23592263
MIRT060556	hsa-miR-448	PAR-CLIP	23592263
MIRT479799	hsa-miR-21-3p	PAR-CLIP	23592263
MIRT479798	hsa-miR-3591-3p	PAR-CLIP	23592263
MIRT479797	hsa-miR-541-5p	PAR-CLIP	23592263
MIRT479796	hsa-miR-4715-5p	PAR-CLIP	23592263
MIRT479795	hsa-miR-5009-3p	PAR-CLIP	23592263
MIRT479794	hsa-miR-676-5p	PAR-CLIP	23592263
MIRT479793	hsa-miR-145-3p	PAR-CLIP	23592263
MIRT479792	hsa-miR-593-5p	PAR-CLIP	23592263
MIRT024995	hsa-miR-183-5p	PAR-CLIP	23592263
MIRT479791	hsa-miR-1271-5p	PAR-CLIP	23592263
MIRT479790	hsa-miR-96-5p	PAR-CLIP	23592263
MIRT479789	hsa-miR-548an	PAR-CLIP	23592263
MIRT479788	hsa-miR-3714	PAR-CLIP	23592263
MIRT479787	hsa-miR-1910-3p	PAR-CLIP	23592263
MIRT479786	hsa-miR-6511a-5p	PAR-CLIP	23592263
MIRT479785	hsa-miR-4464	PAR-CLIP	23592263
MIRT479784	hsa-miR-4748	PAR-CLIP	23592263
MIRT479783	hsa-miR-298	PAR-CLIP	23592263
MIRT479782	hsa-miR-5087	PAR-CLIP	23592263
MIRT479781	hsa-miR-223-5p	PAR-CLIP	23592263
MIRT479780	hsa-miR-6867-5p	PAR-CLIP	23592263
MIRT479779	hsa-miR-6818-5p	PAR-CLIP	23592263
MIRT479778	hsa-miR-147a	PAR-CLIP	23592263
MIRT479777	hsa-miR-5010-3p	PAR-CLIP	23592263
MIRT479776	hsa-miR-574-5p	PAR-CLIP	23592263
MIRT001105	hsa-miR-503-5p	PAR-CLIP	23592263
MIRT060574	hsa-miR-4694-3p	PAR-CLIP	23592263
MIRT060571	hsa-miR-558	PAR-CLIP	23592263
MIRT479775	hsa-miR-4633-3p	PAR-CLIP	23592263
MIRT479774	hsa-miR-6500-5p	PAR-CLIP	23592263
MIRT479773	hsa-miR-95-3p	PAR-CLIP	23592263
MIRT060579	hsa-miR-6874-5p	PAR-CLIP	23592263
MIRT479772	hsa-miR-5197-3p	PAR-CLIP	23592263
MIRT479771	hsa-miR-6873-5p	PAR-CLIP	23592263
MIRT479770	hsa-miR-9500	PAR-CLIP	23592263
MIRT479768	hsa-miR-7845-5p	PAR-CLIP	23592263
MIRT479769	hsa-miR-518c-5p	PAR-CLIP	23592263
MIRT479767	hsa-miR-326	PAR-CLIP	23592263
MIRT479766	hsa-miR-330-5p	PAR-CLIP	23592263
MIRT479765	hsa-miR-6764-3p	PAR-CLIP	23592263
MIRT479764	hsa-miR-6824-3p	PAR-CLIP	23592263
MIRT479763	hsa-miR-3663-5p	PAR-CLIP	23592263
MIRT479762	hsa-miR-1253	PAR-CLIP	23592263
MIRT479761	hsa-miR-3126-5p	PAR-CLIP	23592263
MIRT479760	hsa-miR-6875-5p	PAR-CLIP	23592263
MIRT479759	hsa-miR-7112-3p	PAR-CLIP	23592263
MIRT060569	hsa-miR-6077	PAR-CLIP	23592263
MIRT334157	hsa-miR-593-3p	PAR-CLIP	23592263
MIRT479758	hsa-miR-513a-5p	PAR-CLIP	23592263
MIRT479757	hsa-miR-3191-5p	PAR-CLIP	23592263
MIRT479756	hsa-miR-6843-3p	PAR-CLIP	23592263
MIRT479755	hsa-miR-6848-3p	PAR-CLIP	23592263
MIRT479754	hsa-miR-4458	PAR-CLIP	23592263
MIRT479753	hsa-let-7i-5p	PAR-CLIP	23592263
MIRT006122	hsa-let-7e-5p	PAR-CLIP	23592263
MIRT479752	hsa-miR-98-5p	PAR-CLIP	23592263
MIRT479751	hsa-miR-4500	PAR-CLIP	23592263
MIRT479750	hsa-let-7d-5p	PAR-CLIP	23592263
MIRT479749	hsa-let-7a-5p	PAR-CLIP	23592263
MIRT032092	hsa-let-7f-5p	PAR-CLIP	23592263
MIRT002484	hsa-let-7b-5p	PAR-CLIP	23592263
MIRT479748	hsa-let-7g-5p	PAR-CLIP	23592263
MIRT479747	hsa-let-7c-5p	PAR-CLIP	23592263
MIRT479746	hsa-miR-2392	PAR-CLIP	23592263
MIRT111856	hsa-miR-758-5p	PAR-CLIP	23592263
MIRT479744	hsa-miR-4537	PAR-CLIP	23592263
MIRT479745	hsa-miR-202-3p	PAR-CLIP	23592263
MIRT479743	hsa-miR-8069	PAR-CLIP	23592263
MIRT479742	hsa-miR-1193	PAR-CLIP	23592263
MIRT479741	hsa-miR-380-5p	PAR-CLIP	23592263
MIRT479740	hsa-miR-563	PAR-CLIP	23592263
MIRT479739	hsa-miR-1299	PAR-CLIP	23592263
MIRT479738	hsa-miR-516b-5p	PAR-CLIP	23592263
MIRT479737	hsa-miR-4782-5p	PAR-CLIP	23592263
MIRT479736	hsa-miR-5706	PAR-CLIP	23592263
MIRT334170	hsa-miR-4781-3p	PAR-CLIP	23592263
MIRT334165	hsa-miR-204-3p	PAR-CLIP	23592263
MIRT334168	hsa-miR-4646-5p	PAR-CLIP	23592263
MIRT479735	hsa-miR-7706	PAR-CLIP	23592263
MIRT479734	hsa-miR-4731-5p	PAR-CLIP	23592263
MIRT479733	hsa-miR-5589-5p	PAR-CLIP	23592263
MIRT334167	hsa-miR-4261	PAR-CLIP	23592263
MIRT479732	hsa-miR-4747-5p	PAR-CLIP	23592263
MIRT479731	hsa-miR-5196-5p	PAR-CLIP	23592263
MIRT479730	hsa-miR-3907	PAR-CLIP	23592263
MIRT334169	hsa-miR-4666a-5p	PAR-CLIP	23592263
MIRT268274	hsa-miR-20b-5p	Immunoblot, Immunoprecipitaion, qRT-PCR	26166554
MIRT000480	hsa-miR-193b-3p	Western blot	27071318
MIRT000480	hsa-miR-193b-3p	Western blot	27071318
MIRT268278	hsa-miR-520a-3p	Luciferase reporter assay, qRT-PCR, Western blot	28123641
MIRT000480	hsa-miR-193b-3p	Immunohistochemistry, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	26129688
MIRT000480	hsa-miR-193b-3p	Immunohistochemistry, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	26129688
MIRT731612	hsa-miR-2861	Luciferase reporter assay, Western blot	27364926
MIRT731612	hsa-miR-2861	Luciferase reporter assay, Western blot	27364926
MIRT246929	hsa-miR-193a-3p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	27307030
MIRT246929	hsa-miR-193a-3p	Luciferase reporter assay, Microarray, qRT-PCR, Western blot	27307030
MIRT060555	hsa-miR-340-5p	Luciferase reporter assay, qRT-PCR, Western blot	25817794
MIRT060555	hsa-miR-340-5p	Luciferase reporter assay, qRT-PCR, Western blot	25817794
MIRT020946	hsa-miR-155-5p	Flow, Luciferase reporter assay, qRT-PCR, Western blot	26955820
MIRT020946	hsa-miR-155-5p	Flow, Luciferase reporter assay, qRT-PCR, Western blot	26955820
MIRT000480	hsa-miR-193b-3p	qRT-PCR, Western blot	27071318
MIRT241527	hsa-miR-374a-5p	Luciferase reporter assay, Western blot	27191497
MIRT241527	hsa-miR-374a-5p	Luciferase reporter assay, Western blot	27191497
MIRT479773	hsa-miR-95-3p	Luciferase reporter assay	25971210
MIRT479773	hsa-miR-95-3p	Luciferase reporter assay	25971210
MIRT479773	hsa-miR-95-3p	Luciferase reporter assay	25971210
MIRT479773	hsa-miR-95-3p	Luciferase reporter assay	25971210
MIRT479773	hsa-miR-95-3p	Luciferase reporter assay, qRT-PCR, Western blot	25971210
MIRT479773	hsa-miR-95-3p	Luciferase reporter assay, qRT-PCR, Western blot	25971210
MIRT053080	hsa-miR-138-5p	qRT-PCR	28275859
MIRT000480	hsa-miR-193b-3p	Luciferase reporter assay, Western blot	27918099
MIRT000225	hsa-miR-195-5p	Immunohistochemistry, Luciferase reporter assay, Microarray, qRT-PCR, Western blot	25823925
MIRT023800	hsa-miR-1-3p	Luciferase reporter assay, qRT-PCR, Western blot	27247259
MIRT001227	hsa-miR-15a-5p	Luciferase reporter assay, Western blot	26993269
MIRT001227	hsa-miR-15a-5p	Luciferase reporter assay, Western blot	26993269
MIRT001013	hsa-miR-34a-5p	Luciferase reporter assay, qRT-PCR, Western blot	27220728
MIRT001013	hsa-miR-34a-5p	Luciferase reporter assay, qRT-PCR, Western blot	27220728
MIRT479749	hsa-let-7a-5p	PAR-CLIP	26701625
MIRT002484	hsa-let-7b-5p	PAR-CLIP	26701625
MIRT479747	hsa-let-7c-5p	PAR-CLIP	26701625
MIRT479750	hsa-let-7d-5p	PAR-CLIP	26701625
MIRT006122	hsa-let-7e-5p	PAR-CLIP	26701625
MIRT032092	hsa-let-7f-5p	PAR-CLIP	26701625
MIRT479748	hsa-let-7g-5p	PAR-CLIP	26701625
MIRT479753	hsa-let-7i-5p	PAR-CLIP	26701625
MIRT053230	hsa-miR-106a-5p	PAR-CLIP	26701625
MIRT053230	hsa-miR-106a-5p	PAR-CLIP	26701625
MIRT053230	hsa-miR-106a-5p	PAR-CLIP	26701625
MIRT053230	hsa-miR-106a-5p	PAR-CLIP	26701625
MIRT053230	hsa-miR-106a-5p	PAR-CLIP	26701625
MIRT053230	hsa-miR-106a-5p	PAR-CLIP	26701625
MIRT053230	hsa-miR-106a-5p	PAR-CLIP	26701625
MIRT053230	hsa-miR-106a-5p	PAR-CLIP	26701625
MIRT053230	hsa-miR-106a-5p	PAR-CLIP	26701625
MIRT053230	hsa-miR-106a-5p	PAR-CLIP	26701625
MIRT053230	hsa-miR-106a-5p	PAR-CLIP	26701625
MIRT053230	hsa-miR-106a-5p	PAR-CLIP	26701625
MIRT053230	hsa-miR-106a-5p	PAR-CLIP	26701625
MIRT053230	hsa-miR-106a-5p	PAR-CLIP	26701625
MIRT053230	hsa-miR-106a-5p	PAR-CLIP	26701625
MIRT053230	hsa-miR-106a-5p	PAR-CLIP	26701625
MIRT005861	hsa-miR-106b-5p	PAR-CLIP	26701625
MIRT005861	hsa-miR-106b-5p	PAR-CLIP	26701625
MIRT005861	hsa-miR-106b-5p	PAR-CLIP	26701625
MIRT005861	hsa-miR-106b-5p	PAR-CLIP	26701625
MIRT005861	hsa-miR-106b-5p	PAR-CLIP	26701625
MIRT005861	hsa-miR-106b-5p	PAR-CLIP	26701625
MIRT005861	hsa-miR-106b-5p	PAR-CLIP	26701625
MIRT005861	hsa-miR-106b-5p	PAR-CLIP	26701625
MIRT005861	hsa-miR-106b-5p	PAR-CLIP	26701625
MIRT005861	hsa-miR-106b-5p	PAR-CLIP	26701625
MIRT005861	hsa-miR-106b-5p	PAR-CLIP	26701625
MIRT005861	hsa-miR-106b-5p	PAR-CLIP	26701625
MIRT005861	hsa-miR-106b-5p	PAR-CLIP	26701625
MIRT005861	hsa-miR-106b-5p	PAR-CLIP	26701625
MIRT005861	hsa-miR-106b-5p	PAR-CLIP	26701625
MIRT005861	hsa-miR-106b-5p	PAR-CLIP	26701625
MIRT502985	hsa-miR-1257	PAR-CLIP	26701625
MIRT479739	hsa-miR-1299	PAR-CLIP	26701625
MIRT060553	hsa-miR-142-5p	PAR-CLIP	26701625
MIRT060553	hsa-miR-142-5p	PAR-CLIP	26701625
MIRT060553	hsa-miR-142-5p	PAR-CLIP	26701625
MIRT060553	hsa-miR-142-5p	PAR-CLIP	26701625
MIRT060553	hsa-miR-142-5p	PAR-CLIP	26701625
MIRT060553	hsa-miR-142-5p	PAR-CLIP	26701625
MIRT060553	hsa-miR-142-5p	PAR-CLIP	26701625
MIRT060553	hsa-miR-142-5p	PAR-CLIP	26701625
MIRT060553	hsa-miR-142-5p	PAR-CLIP	26701625
MIRT060553	hsa-miR-142-5p	PAR-CLIP	26701625
MIRT060553	hsa-miR-142-5p	PAR-CLIP	26701625
MIRT060553	hsa-miR-142-5p	PAR-CLIP	26701625
MIRT060553	hsa-miR-142-5p	PAR-CLIP	26701625
MIRT060553	hsa-miR-142-5p	PAR-CLIP	26701625
MIRT060553	hsa-miR-142-5p	PAR-CLIP	26701625
MIRT060553	hsa-miR-142-5p	PAR-CLIP	26701625
MIRT479778	hsa-miR-147a	PAR-CLIP	26701625
MIRT479778	hsa-miR-147a	PAR-CLIP	26701625
MIRT005287	hsa-miR-17-5p	PAR-CLIP	26701625
MIRT005287	hsa-miR-17-5p	PAR-CLIP	26701625
MIRT005287	hsa-miR-17-5p	PAR-CLIP	26701625
MIRT005287	hsa-miR-17-5p	PAR-CLIP	26701625
MIRT005287	hsa-miR-17-5p	PAR-CLIP	26701625
MIRT005287	hsa-miR-17-5p	PAR-CLIP	26701625
MIRT005287	hsa-miR-17-5p	PAR-CLIP	26701625
MIRT005287	hsa-miR-17-5p	PAR-CLIP	26701625
MIRT005287	hsa-miR-17-5p	PAR-CLIP	26701625
MIRT005287	hsa-miR-17-5p	PAR-CLIP	26701625
MIRT005287	hsa-miR-17-5p	PAR-CLIP	26701625
MIRT005287	hsa-miR-17-5p	PAR-CLIP	26701625
MIRT005287	hsa-miR-17-5p	PAR-CLIP	26701625
MIRT005287	hsa-miR-17-5p	PAR-CLIP	26701625
MIRT005287	hsa-miR-17-5p	PAR-CLIP	26701625
MIRT005287	hsa-miR-17-5p	PAR-CLIP	26701625
MIRT479787	hsa-miR-1910-3p	PAR-CLIP	26701625
MIRT479787	hsa-miR-1910-3p	PAR-CLIP	26701625
MIRT479787	hsa-miR-1910-3p	PAR-CLIP	26701625
MIRT479787	hsa-miR-1910-3p	PAR-CLIP	26701625
MIRT479745	hsa-miR-202-3p	PAR-CLIP	26701625
MIRT000179	hsa-miR-20a-5p	PAR-CLIP	26701625
MIRT000179	hsa-miR-20a-5p	PAR-CLIP	26701625
MIRT000179	hsa-miR-20a-5p	PAR-CLIP	26701625
MIRT000179	hsa-miR-20a-5p	PAR-CLIP	26701625
MIRT000179	hsa-miR-20a-5p	PAR-CLIP	26701625
MIRT000179	hsa-miR-20a-5p	PAR-CLIP	26701625
MIRT000179	hsa-miR-20a-5p	PAR-CLIP	26701625
MIRT000179	hsa-miR-20a-5p	PAR-CLIP	26701625
MIRT000179	hsa-miR-20a-5p	PAR-CLIP	26701625
MIRT000179	hsa-miR-20a-5p	PAR-CLIP	26701625
MIRT000179	hsa-miR-20a-5p	PAR-CLIP	26701625
MIRT000179	hsa-miR-20a-5p	PAR-CLIP	26701625
MIRT000179	hsa-miR-20a-5p	PAR-CLIP	26701625
MIRT000179	hsa-miR-20a-5p	PAR-CLIP	26701625
MIRT000179	hsa-miR-20a-5p	PAR-CLIP	26701625
MIRT000179	hsa-miR-20a-5p	PAR-CLIP	26701625
MIRT268274	hsa-miR-20b-5p	PAR-CLIP	26701625
MIRT268274	hsa-miR-20b-5p	PAR-CLIP	26701625
MIRT268274	hsa-miR-20b-5p	PAR-CLIP	26701625
MIRT268274	hsa-miR-20b-5p	PAR-CLIP	26701625
MIRT268274	hsa-miR-20b-5p	PAR-CLIP	26701625
MIRT268274	hsa-miR-20b-5p	PAR-CLIP	26701625
MIRT268274	hsa-miR-20b-5p	PAR-CLIP	26701625
MIRT268274	hsa-miR-20b-5p	PAR-CLIP	26701625
MIRT268274	hsa-miR-20b-5p	PAR-CLIP	26701625
MIRT268274	hsa-miR-20b-5p	PAR-CLIP	26701625
MIRT268274	hsa-miR-20b-5p	PAR-CLIP	26701625
MIRT268274	hsa-miR-20b-5p	PAR-CLIP	26701625
MIRT268274	hsa-miR-20b-5p	PAR-CLIP	26701625
MIRT268274	hsa-miR-20b-5p	PAR-CLIP	26701625
MIRT268274	hsa-miR-20b-5p	PAR-CLIP	26701625
MIRT268274	hsa-miR-20b-5p	PAR-CLIP	26701625
MIRT479781	hsa-miR-223-5p	PAR-CLIP	26701625
MIRT479781	hsa-miR-223-5p	PAR-CLIP	26701625
MIRT732956	hsa-miR-224-5p	PAR-CLIP	26701625
MIRT479746	hsa-miR-2392	PAR-CLIP	26701625
MIRT479783	hsa-miR-298	PAR-CLIP	26701625
MIRT479783	hsa-miR-298	PAR-CLIP	26701625
MIRT479783	hsa-miR-298	PAR-CLIP	26701625
MIRT479783	hsa-miR-298	PAR-CLIP	26701625
MIRT060555	hsa-miR-340-5p	PAR-CLIP	26701625
MIRT060555	hsa-miR-340-5p	PAR-CLIP	26701625
MIRT060555	hsa-miR-340-5p	PAR-CLIP	26701625
MIRT060555	hsa-miR-340-5p	PAR-CLIP	26701625
MIRT060555	hsa-miR-340-5p	PAR-CLIP	26701625
MIRT060555	hsa-miR-340-5p	PAR-CLIP	26701625
MIRT060555	hsa-miR-340-5p	PAR-CLIP	26701625
MIRT060555	hsa-miR-340-5p	PAR-CLIP	26701625
MIRT060555	hsa-miR-340-5p	PAR-CLIP	26701625
MIRT060555	hsa-miR-340-5p	PAR-CLIP	26701625
MIRT060555	hsa-miR-340-5p	PAR-CLIP	26701625
MIRT060555	hsa-miR-340-5p	PAR-CLIP	26701625
MIRT060555	hsa-miR-340-5p	PAR-CLIP	26701625
MIRT060555	hsa-miR-340-5p	PAR-CLIP	26701625
MIRT060555	hsa-miR-340-5p	PAR-CLIP	26701625
MIRT060555	hsa-miR-340-5p	PAR-CLIP	26701625
MIRT060558	hsa-miR-3609	PAR-CLIP	26701625
MIRT060558	hsa-miR-3609	PAR-CLIP	26701625
MIRT060558	hsa-miR-3609	PAR-CLIP	26701625
MIRT060558	hsa-miR-3609	PAR-CLIP	26701625
MIRT060558	hsa-miR-3609	PAR-CLIP	26701625
MIRT060558	hsa-miR-3609	PAR-CLIP	26701625
MIRT060558	hsa-miR-3609	PAR-CLIP	26701625
MIRT060558	hsa-miR-3609	PAR-CLIP	26701625
MIRT060558	hsa-miR-3609	PAR-CLIP	26701625
MIRT060558	hsa-miR-3609	PAR-CLIP	26701625
MIRT060558	hsa-miR-3609	PAR-CLIP	26701625
MIRT060558	hsa-miR-3609	PAR-CLIP	26701625
MIRT060558	hsa-miR-3609	PAR-CLIP	26701625
MIRT060558	hsa-miR-3609	PAR-CLIP	26701625
MIRT060558	hsa-miR-3609	PAR-CLIP	26701625
MIRT060558	hsa-miR-3609	PAR-CLIP	26701625
MIRT479788	hsa-miR-3714	PAR-CLIP	26701625
MIRT479788	hsa-miR-3714	PAR-CLIP	26701625
MIRT479788	hsa-miR-3714	PAR-CLIP	26701625
MIRT479788	hsa-miR-3714	PAR-CLIP	26701625
MIRT479741	hsa-miR-380-5p	PAR-CLIP	26701625
MIRT479754	hsa-miR-4458	PAR-CLIP	26701625
MIRT479785	hsa-miR-4464	PAR-CLIP	26701625
MIRT479785	hsa-miR-4464	PAR-CLIP	26701625
MIRT479785	hsa-miR-4464	PAR-CLIP	26701625
MIRT479785	hsa-miR-4464	PAR-CLIP	26701625
MIRT060556	hsa-miR-448	PAR-CLIP	26701625
MIRT060556	hsa-miR-448	PAR-CLIP	26701625
MIRT060556	hsa-miR-448	PAR-CLIP	26701625
MIRT060556	hsa-miR-448	PAR-CLIP	26701625
MIRT060556	hsa-miR-448	PAR-CLIP	26701625
MIRT060556	hsa-miR-448	PAR-CLIP	26701625
MIRT060556	hsa-miR-448	PAR-CLIP	26701625
MIRT060556	hsa-miR-448	PAR-CLIP	26701625
MIRT060556	hsa-miR-448	PAR-CLIP	26701625
MIRT060556	hsa-miR-448	PAR-CLIP	26701625
MIRT060556	hsa-miR-448	PAR-CLIP	26701625
MIRT060556	hsa-miR-448	PAR-CLIP	26701625
MIRT060556	hsa-miR-448	PAR-CLIP	26701625
MIRT060556	hsa-miR-448	PAR-CLIP	26701625
MIRT060556	hsa-miR-448	PAR-CLIP	26701625
MIRT060556	hsa-miR-448	PAR-CLIP	26701625
MIRT479751	hsa-miR-4500	PAR-CLIP	26701625
MIRT479744	hsa-miR-4537	PAR-CLIP	26701625
MIRT479775	hsa-miR-4633-3p	PAR-CLIP	26701625
MIRT479775	hsa-miR-4633-3p	PAR-CLIP	26701625
MIRT479775	hsa-miR-4633-3p	PAR-CLIP	26701625
MIRT479775	hsa-miR-4633-3p	PAR-CLIP	26701625
MIRT060585	hsa-miR-4672	PAR-CLIP	26701625
MIRT060574	hsa-miR-4694-3p	PAR-CLIP	26701625
MIRT060574	hsa-miR-4694-3p	PAR-CLIP	26701625
MIRT060574	hsa-miR-4694-3p	PAR-CLIP	26701625
MIRT060574	hsa-miR-4694-3p	PAR-CLIP	26701625
MIRT060574	hsa-miR-4694-3p	PAR-CLIP	26701625
MIRT479784	hsa-miR-4748	PAR-CLIP	26701625
MIRT479784	hsa-miR-4748	PAR-CLIP	26701625
MIRT479784	hsa-miR-4748	PAR-CLIP	26701625
MIRT479784	hsa-miR-4748	PAR-CLIP	26701625
MIRT246924	hsa-miR-4756-3p	PAR-CLIP	26701625
MIRT246924	hsa-miR-4756-3p	PAR-CLIP	26701625
MIRT479737	hsa-miR-4782-5p	PAR-CLIP	26701625
MIRT479801	hsa-miR-4796-3p	PAR-CLIP	26701625
MIRT479801	hsa-miR-4796-3p	PAR-CLIP	26701625
MIRT479801	hsa-miR-4796-3p	PAR-CLIP	26701625
MIRT479801	hsa-miR-4796-3p	PAR-CLIP	26701625
MIRT479801	hsa-miR-4796-3p	PAR-CLIP	26701625
MIRT479801	hsa-miR-4796-3p	PAR-CLIP	26701625
MIRT479801	hsa-miR-4796-3p	PAR-CLIP	26701625
MIRT479801	hsa-miR-4796-3p	PAR-CLIP	26701625
MIRT479801	hsa-miR-4796-3p	PAR-CLIP	26701625
MIRT479801	hsa-miR-4796-3p	PAR-CLIP	26701625
MIRT479801	hsa-miR-4796-3p	PAR-CLIP	26701625
MIRT479801	hsa-miR-4796-3p	PAR-CLIP	26701625
MIRT479801	hsa-miR-4796-3p	PAR-CLIP	26701625
MIRT479801	hsa-miR-4796-3p	PAR-CLIP	26701625
MIRT479801	hsa-miR-4796-3p	PAR-CLIP	26701625
MIRT479801	hsa-miR-4796-3p	PAR-CLIP	26701625
MIRT479777	hsa-miR-5010-3p	PAR-CLIP	26701625
MIRT479777	hsa-miR-5010-3p	PAR-CLIP	26701625
MIRT479777	hsa-miR-5010-3p	PAR-CLIP	26701625
MIRT479777	hsa-miR-5010-3p	PAR-CLIP	26701625
MIRT479782	hsa-miR-5087	PAR-CLIP	26701625
MIRT479782	hsa-miR-5087	PAR-CLIP	26701625
MIRT479782	hsa-miR-5087	PAR-CLIP	26701625
MIRT479782	hsa-miR-5087	PAR-CLIP	26701625
MIRT479782	hsa-miR-5087	PAR-CLIP	26701625
MIRT479738	hsa-miR-516b-5p	PAR-CLIP	26701625
MIRT268282	hsa-miR-519d-3p	PAR-CLIP	26701625
MIRT268282	hsa-miR-519d-3p	PAR-CLIP	26701625
MIRT268282	hsa-miR-519d-3p	PAR-CLIP	26701625
MIRT268282	hsa-miR-519d-3p	PAR-CLIP	26701625
MIRT268282	hsa-miR-519d-3p	PAR-CLIP	26701625
MIRT268282	hsa-miR-519d-3p	PAR-CLIP	26701625
MIRT268282	hsa-miR-519d-3p	PAR-CLIP	26701625
MIRT268282	hsa-miR-519d-3p	PAR-CLIP	26701625
MIRT268282	hsa-miR-519d-3p	PAR-CLIP	26701625
MIRT268282	hsa-miR-519d-3p	PAR-CLIP	26701625
MIRT268282	hsa-miR-519d-3p	PAR-CLIP	26701625
MIRT268282	hsa-miR-519d-3p	PAR-CLIP	26701625
MIRT268282	hsa-miR-519d-3p	PAR-CLIP	26701625
MIRT268282	hsa-miR-519d-3p	PAR-CLIP	26701625
MIRT268282	hsa-miR-519d-3p	PAR-CLIP	26701625
MIRT268282	hsa-miR-519d-3p	PAR-CLIP	26701625
MIRT268279	hsa-miR-526b-3p	PAR-CLIP	26701625
MIRT268279	hsa-miR-526b-3p	PAR-CLIP	26701625
MIRT268279	hsa-miR-526b-3p	PAR-CLIP	26701625
MIRT268279	hsa-miR-526b-3p	PAR-CLIP	26701625
MIRT268279	hsa-miR-526b-3p	PAR-CLIP	26701625
MIRT268279	hsa-miR-526b-3p	PAR-CLIP	26701625
MIRT268279	hsa-miR-526b-3p	PAR-CLIP	26701625
MIRT268279	hsa-miR-526b-3p	PAR-CLIP	26701625
MIRT268279	hsa-miR-526b-3p	PAR-CLIP	26701625
MIRT268279	hsa-miR-526b-3p	PAR-CLIP	26701625
MIRT268279	hsa-miR-526b-3p	PAR-CLIP	26701625
MIRT268279	hsa-miR-526b-3p	PAR-CLIP	26701625
MIRT268279	hsa-miR-526b-3p	PAR-CLIP	26701625
MIRT268279	hsa-miR-526b-3p	PAR-CLIP	26701625
MIRT268279	hsa-miR-526b-3p	PAR-CLIP	26701625
MIRT268279	hsa-miR-526b-3p	PAR-CLIP	26701625
MIRT060559	hsa-miR-548ah-5p	PAR-CLIP	26701625
MIRT060559	hsa-miR-548ah-5p	PAR-CLIP	26701625
MIRT060559	hsa-miR-548ah-5p	PAR-CLIP	26701625
MIRT060559	hsa-miR-548ah-5p	PAR-CLIP	26701625
MIRT060559	hsa-miR-548ah-5p	PAR-CLIP	26701625
MIRT060559	hsa-miR-548ah-5p	PAR-CLIP	26701625
MIRT060559	hsa-miR-548ah-5p	PAR-CLIP	26701625
MIRT060559	hsa-miR-548ah-5p	PAR-CLIP	26701625
MIRT060559	hsa-miR-548ah-5p	PAR-CLIP	26701625
MIRT060559	hsa-miR-548ah-5p	PAR-CLIP	26701625
MIRT060559	hsa-miR-548ah-5p	PAR-CLIP	26701625
MIRT060559	hsa-miR-548ah-5p	PAR-CLIP	26701625
MIRT060559	hsa-miR-548ah-5p	PAR-CLIP	26701625
MIRT060559	hsa-miR-548ah-5p	PAR-CLIP	26701625
MIRT060559	hsa-miR-548ah-5p	PAR-CLIP	26701625
MIRT060559	hsa-miR-548ah-5p	PAR-CLIP	26701625
MIRT479789	hsa-miR-548an	PAR-CLIP	26701625
MIRT479789	hsa-miR-548an	PAR-CLIP	26701625
MIRT479789	hsa-miR-548an	PAR-CLIP	26701625
MIRT479789	hsa-miR-548an	PAR-CLIP	26701625
MIRT479800	hsa-miR-556-5p	PAR-CLIP	26701625
MIRT479800	hsa-miR-556-5p	PAR-CLIP	26701625
MIRT479800	hsa-miR-556-5p	PAR-CLIP	26701625
MIRT479800	hsa-miR-556-5p	PAR-CLIP	26701625
MIRT479800	hsa-miR-556-5p	PAR-CLIP	26701625
MIRT479800	hsa-miR-556-5p	PAR-CLIP	26701625
MIRT479800	hsa-miR-556-5p	PAR-CLIP	26701625
MIRT479800	hsa-miR-556-5p	PAR-CLIP	26701625
MIRT479800	hsa-miR-556-5p	PAR-CLIP	26701625
MIRT479800	hsa-miR-556-5p	PAR-CLIP	26701625
MIRT479800	hsa-miR-556-5p	PAR-CLIP	26701625
MIRT479800	hsa-miR-556-5p	PAR-CLIP	26701625
MIRT479800	hsa-miR-556-5p	PAR-CLIP	26701625
MIRT479800	hsa-miR-556-5p	PAR-CLIP	26701625
MIRT479800	hsa-miR-556-5p	PAR-CLIP	26701625
MIRT479800	hsa-miR-556-5p	PAR-CLIP	26701625
MIRT060571	hsa-miR-558	PAR-CLIP	26701625
MIRT060571	hsa-miR-558	PAR-CLIP	26701625
MIRT060571	hsa-miR-558	PAR-CLIP	26701625
MIRT060571	hsa-miR-558	PAR-CLIP	26701625
MIRT060561	hsa-miR-5590-3p	PAR-CLIP	26701625
MIRT060561	hsa-miR-5590-3p	PAR-CLIP	26701625
MIRT060561	hsa-miR-5590-3p	PAR-CLIP	26701625
MIRT060561	hsa-miR-5590-3p	PAR-CLIP	26701625
MIRT060561	hsa-miR-5590-3p	PAR-CLIP	26701625
MIRT060561	hsa-miR-5590-3p	PAR-CLIP	26701625
MIRT060561	hsa-miR-5590-3p	PAR-CLIP	26701625
MIRT060561	hsa-miR-5590-3p	PAR-CLIP	26701625
MIRT060561	hsa-miR-5590-3p	PAR-CLIP	26701625
MIRT060561	hsa-miR-5590-3p	PAR-CLIP	26701625
MIRT060561	hsa-miR-5590-3p	PAR-CLIP	26701625
MIRT060561	hsa-miR-5590-3p	PAR-CLIP	26701625
MIRT060561	hsa-miR-5590-3p	PAR-CLIP	26701625
MIRT060561	hsa-miR-5590-3p	PAR-CLIP	26701625
MIRT060561	hsa-miR-5590-3p	PAR-CLIP	26701625
MIRT060561	hsa-miR-5590-3p	PAR-CLIP	26701625
MIRT479740	hsa-miR-563	PAR-CLIP	26701625
MIRT479736	hsa-miR-5706	PAR-CLIP	26701625
MIRT479776	hsa-miR-574-5p	PAR-CLIP	26701625
MIRT479776	hsa-miR-574-5p	PAR-CLIP	26701625
MIRT479776	hsa-miR-574-5p	PAR-CLIP	26701625
MIRT479776	hsa-miR-574-5p	PAR-CLIP	26701625
MIRT479774	hsa-miR-6500-5p	PAR-CLIP	26701625
MIRT479774	hsa-miR-6500-5p	PAR-CLIP	26701625
MIRT479774	hsa-miR-6500-5p	PAR-CLIP	26701625
MIRT479774	hsa-miR-6500-5p	PAR-CLIP	26701625
MIRT479786	hsa-miR-6511a-5p	PAR-CLIP	26701625
MIRT479786	hsa-miR-6511a-5p	PAR-CLIP	26701625
MIRT479786	hsa-miR-6511a-5p	PAR-CLIP	26701625
MIRT479786	hsa-miR-6511a-5p	PAR-CLIP	26701625
MIRT502988	hsa-miR-6768-5p	PAR-CLIP	26701625
MIRT479779	hsa-miR-6818-5p	PAR-CLIP	26701625
MIRT479779	hsa-miR-6818-5p	PAR-CLIP	26701625
MIRT479779	hsa-miR-6818-5p	PAR-CLIP	26701625
MIRT479779	hsa-miR-6818-5p	PAR-CLIP	26701625
MIRT479780	hsa-miR-6867-5p	PAR-CLIP	26701625
MIRT479780	hsa-miR-6867-5p	PAR-CLIP	26701625
MIRT479780	hsa-miR-6867-5p	PAR-CLIP	26701625
MIRT479780	hsa-miR-6867-5p	PAR-CLIP	26701625
MIRT060579	hsa-miR-6874-5p	PAR-CLIP	26701625
MIRT060579	hsa-miR-6874-5p	PAR-CLIP	26701625
MIRT060579	hsa-miR-6874-5p	PAR-CLIP	26701625
MIRT060579	hsa-miR-6874-5p	PAR-CLIP	26701625
MIRT111856	hsa-miR-758-5p	PAR-CLIP	26701625
MIRT479743	hsa-miR-8069	PAR-CLIP	26701625
MIRT479743	hsa-miR-8069	PAR-CLIP	26701625
MIRT028002	hsa-miR-93-5p	PAR-CLIP	26701625
MIRT028002	hsa-miR-93-5p	PAR-CLIP	26701625
MIRT028002	hsa-miR-93-5p	PAR-CLIP	26701625
MIRT028002	hsa-miR-93-5p	PAR-CLIP	26701625
MIRT028002	hsa-miR-93-5p	PAR-CLIP	26701625
MIRT028002	hsa-miR-93-5p	PAR-CLIP	26701625
MIRT028002	hsa-miR-93-5p	PAR-CLIP	26701625
MIRT028002	hsa-miR-93-5p	PAR-CLIP	26701625
MIRT028002	hsa-miR-93-5p	PAR-CLIP	26701625
MIRT028002	hsa-miR-93-5p	PAR-CLIP	26701625
MIRT028002	hsa-miR-93-5p	PAR-CLIP	26701625
MIRT028002	hsa-miR-93-5p	PAR-CLIP	26701625
MIRT028002	hsa-miR-93-5p	PAR-CLIP	26701625
MIRT028002	hsa-miR-93-5p	PAR-CLIP	26701625
MIRT028002	hsa-miR-93-5p	PAR-CLIP	26701625
MIRT028002	hsa-miR-93-5p	PAR-CLIP	26701625
MIRT479773	hsa-miR-95-3p	PAR-CLIP	26701625
MIRT479773	hsa-miR-95-3p	PAR-CLIP	26701625
MIRT479773	hsa-miR-95-3p	PAR-CLIP	26701625
MIRT479752	hsa-miR-98-5p	PAR-CLIP	26701625
MIRT053230	hsa-miR-106a-5p	PAR-CLIP	27292025
MIRT005861	hsa-miR-106b-5p	PAR-CLIP	27292025
MIRT060576	hsa-miR-1199-3p	PAR-CLIP	27292025
MIRT060572	hsa-miR-1234-3p	PAR-CLIP	27292025
MIRT060553	hsa-miR-142-5p	PAR-CLIP	27292025
MIRT479778	hsa-miR-147a	PAR-CLIP	27292025
MIRT005287	hsa-miR-17-5p	PAR-CLIP	27292025
MIRT479787	hsa-miR-1910-3p	PAR-CLIP	27292025
MIRT000179	hsa-miR-20a-5p	PAR-CLIP	27292025
MIRT268274	hsa-miR-20b-5p	PAR-CLIP	27292025
MIRT060570	hsa-miR-214-5p	PAR-CLIP	27292025
MIRT479781	hsa-miR-223-5p	PAR-CLIP	27292025
MIRT479783	hsa-miR-298	PAR-CLIP	27292025
MIRT060555	hsa-miR-340-5p	PAR-CLIP	27292025
MIRT060558	hsa-miR-3609	PAR-CLIP	27292025
MIRT479788	hsa-miR-3714	PAR-CLIP	27292025
MIRT060560	hsa-miR-3973	PAR-CLIP	27292025
MIRT479785	hsa-miR-4464	PAR-CLIP	27292025
MIRT060556	hsa-miR-448	PAR-CLIP	27292025
MIRT479775	hsa-miR-4633-3p	PAR-CLIP	27292025
MIRT060574	hsa-miR-4694-3p	PAR-CLIP	27292025
MIRT246923	hsa-miR-4708-5p	PAR-CLIP	27292025
MIRT479784	hsa-miR-4748	PAR-CLIP	27292025
MIRT246924	hsa-miR-4756-3p	PAR-CLIP	27292025
MIRT246924	hsa-miR-4756-3p	PAR-CLIP	27292025
MIRT479801	hsa-miR-4796-3p	PAR-CLIP	27292025
MIRT541404	hsa-miR-4797-5p	PAR-CLIP	27292025
MIRT479777	hsa-miR-5010-3p	PAR-CLIP	27292025
MIRT479782	hsa-miR-5087	PAR-CLIP	27292025
MIRT268282	hsa-miR-519d-3p	PAR-CLIP	27292025
MIRT268279	hsa-miR-526b-3p	PAR-CLIP	27292025
MIRT060559	hsa-miR-548ah-5p	PAR-CLIP	27292025
MIRT479789	hsa-miR-548an	PAR-CLIP	27292025
MIRT060562	hsa-miR-548av-5p	PAR-CLIP	27292025
MIRT060557	hsa-miR-548k	PAR-CLIP	27292025
MIRT479800	hsa-miR-556-5p	PAR-CLIP	27292025
MIRT060571	hsa-miR-558	PAR-CLIP	27292025
MIRT060561	hsa-miR-5590-3p	PAR-CLIP	27292025
MIRT479776	hsa-miR-574-5p	PAR-CLIP	27292025
MIRT479774	hsa-miR-6500-5p	PAR-CLIP	27292025
MIRT479786	hsa-miR-6511a-5p	PAR-CLIP	27292025
MIRT060577	hsa-miR-6735-3p	PAR-CLIP	27292025
MIRT060578	hsa-miR-6748-3p	PAR-CLIP	27292025
MIRT479779	hsa-miR-6818-5p	PAR-CLIP	27292025
MIRT479780	hsa-miR-6867-5p	PAR-CLIP	27292025
MIRT060579	hsa-miR-6874-5p	PAR-CLIP	27292025
MIRT060580	hsa-miR-7107-5p	PAR-CLIP	27292025
MIRT060563	hsa-miR-8054	PAR-CLIP	27292025
MIRT028002	hsa-miR-93-5p	PAR-CLIP	27292025
MIRT479773	hsa-miR-95-3p	PAR-CLIP	27292025
MIRT479787	hsa-miR-1910-3p	HITS-CLIP	27418678
MIRT479781	hsa-miR-223-5p	HITS-CLIP	27418678
MIRT479781	hsa-miR-223-5p	HITS-CLIP	27418678
MIRT479781	hsa-miR-223-5p	HITS-CLIP	27418678
MIRT479783	hsa-miR-298	HITS-CLIP	27418678
MIRT479788	hsa-miR-3714	HITS-CLIP	27418678
MIRT479785	hsa-miR-4464	HITS-CLIP	27418678
MIRT479784	hsa-miR-4748	HITS-CLIP	27418678
MIRT479782	hsa-miR-5087	HITS-CLIP	27418678
MIRT479776	hsa-miR-574-5p	HITS-CLIP	27418678
MIRT479776	hsa-miR-574-5p	HITS-CLIP	27418678
MIRT479776	hsa-miR-574-5p	HITS-CLIP	27418678
MIRT479786	hsa-miR-6511a-5p	HITS-CLIP	27418678
MIRT479779	hsa-miR-6818-5p	HITS-CLIP	27418678
MIRT479780	hsa-miR-6867-5p	HITS-CLIP	27418678
MIRT479780	hsa-miR-6867-5p	HITS-CLIP	27418678
MIRT479780	hsa-miR-6867-5p	HITS-CLIP	27418678
MIRT732807	hsa-miR-455-3p	Luciferase reporter assay, Microarray, qRT-PCR, Western blotting	33505218
MIRT732956	hsa-miR-224-5p	qRT-PCR	31434359
MIRT000179	hsa-miR-20a-5p	Immunohistochemistry (IHC), Luciferase reporter assay, Western blotting	34096637
MIRT000179	hsa-miR-20a-5p	Immunohistochemistry (IHC), Luciferase reporter assay, Western blotting	34096637
MIRT733546	hsa-miR-486-3p	Immunofluorescence, Immunoprecipitaion (IP), Luciferase reporter assay, qRT-PCR, Western blotting	34080770
MIRT246929	hsa-miR-193a-3p	Luciferase reporter assay, qRT-PCR	32705210
MIRT246929	hsa-miR-193a-3p	Luciferase reporter assay, qRT-PCR	32705210
MIRT733632	hsa-miR-1301-3p	Immunohistochemistry (IHC), Luciferase reporter assay, qRT-PCR, Western blotting	33987098
MIRT006657	hsa-miR-16-5p	Immunohistochemistry (IHC), qRT-PCR, Western blotting	33122919
MIRT479747	hsa-let-7c-5p	ELISA, Immunofluorescence, Immunoprecipitaion (IP), Luciferase reporter assay, qRT-PCR, Western blotting	33982124
MIRT733702	hsa-miR-26a-5p	ELISA, Immunoprecipitaion (IP), Luciferase reporter assay, Western blotting	33857357
MIRT001013	hsa-miR-34a-5p	Immunocytochemistry (ICC), RNA-seq, qRT-PCR	33748099
MIRT479793	hsa-miR-145-3p	Luciferase reporter assay, qRT-PCR, Western blotting	32588730
MIRT734165	hsa-miR-7-2-3p	Immunohistochemistry (IHC), Microarray	31538956
MIRT734165	hsa-miR-7-2-3p	Immunohistochemistry (IHC), Microarray	31538956
MIRT734325	hsa-miR-33b-5p	Luciferase reporter assay, qRT-PCR	31822509
MIRT479790	hsa-miR-96-3p	Luciferase reporter assay, qRT-PCR	31822509
MIRT001105	hsa-miR-503-5p	Luciferase reporter assay, qRT-PCR	31822509
MIRT734778	hsa-miR-194-3p	Luciferase reporter assay, Western blotting, RNA-seq, qRT-PCR, Flow cytometry	33605558
MIRT006657	hsa-miR-16-5p	Microarray	33530159
MIRT735227	hsa-miR-181a-5p	Western blotting, qRT-PCR	32566002
MIRT003426	hsa-miR-19a-3p	qRT-PCR	32165872
MIRT735636	hsa-miR-502-5p	Luciferase reporter assay, Western blotting, Immunohistochemistry (IHC), qRT-PCR, In situ hybridization	31971654
MIRT735994	hsa-miR-520d-3p	Microarray	31593492
MIRT006657	hsa-miR-16-5p	Luciferase reporter assay, Western blotting, qRT-PCR, Flow cytometry	31497196
MIRT736317	hsa-miR-1914-5p	Luciferase reporter assay, Western blotting, Immunoprecipitaion (IP), Immunohistochemistry (IHC), Immunofluorescence, qRT-PCR	31590696
MIRT479797	hsa-miR-541-5p	Luciferase reporter assay, Western blotting, Immunoprecipitaion (IP), Immunohistochemistry (IHC), Immunofluorescence, qRT-PCR	31590696
MIRT736843	hsa-miR-134-3p	Western blotting, Immunoprecipitaion (IP), Immunofluorescence, qRT-PCR	31426282
MIRT737138	hsa-miR-15b-3p	Luciferase reporter assay, Western blotting, Microarray, Immunoprecipitaion (IP), qRT-PCR, Flow cytometry	33519190
MIRT737483	hsa-miR-93-3p	Luciferase reporter assay, Western blotting, RNA-seq, ELISA	34197043
MIRT737484	hsa-miR-106b-3p	Luciferase reporter assay, Western blotting, RNA-seq, ELISA	34197043
MIRT268282	hsa-miR-519d-3p	HITS-CLIP	21572407
MIRT005287	hsa-miR-17-5p	HITS-CLIP	21572407
MIRT268274	hsa-miR-20b-5p	HITS-CLIP	21572407
MIRT268279	hsa-miR-526b-3p	HITS-CLIP	21572407
MIRT028002	hsa-miR-93-5p	HITS-CLIP	21572407
MIRT053230	hsa-miR-106a-5p	HITS-CLIP	21572407
MIRT005861	hsa-miR-106b-5p	HITS-CLIP	21572407
MIRT000179	hsa-miR-20a-5p	HITS-CLIP	21572407
MIRT060553	hsa-miR-142-5p	HITS-CLIP	21572407
MIRT060561	hsa-miR-5590-3p	HITS-CLIP	21572407
MIRT060558	hsa-miR-3609	HITS-CLIP	21572407
MIRT060559	hsa-miR-548ah-5p	HITS-CLIP	21572407
MIRT479801	hsa-miR-4796-3p	HITS-CLIP	21572407
MIRT479800	hsa-miR-556-5p	HITS-CLIP	21572407
MIRT060555	hsa-miR-340-5p	HITS-CLIP	21572407
MIRT060556	hsa-miR-448	HITS-CLIP	21572407
MIRT502984	hsa-miR-944	HITS-CLIP	21572407
MIRT054910	hsa-miR-603	HITS-CLIP	21572407
MIRT502983	hsa-miR-369-3p	HITS-CLIP	21572407
MIRT502982	hsa-miR-5692b	HITS-CLIP	21572407
MIRT502981	hsa-miR-5692c	HITS-CLIP	21572407
MIRT268292	hsa-miR-216b-3p	HITS-CLIP	21572407
MIRT268294	hsa-miR-6500-3p	HITS-CLIP	21572407
MIRT502980	hsa-miR-891b	HITS-CLIP	21572407
MIRT241527	hsa-miR-374a-5p	HITS-CLIP	21572407
MIRT016061	hsa-miR-374b-5p	HITS-CLIP	21572407
MIRT268291	hsa-miR-491-3p	HITS-CLIP	21572407
MIRT704892	hsa-miR-3922-5p	HITS-CLIP	23313552
MIRT704891	hsa-miR-6884-3p	HITS-CLIP	23313552
MIRT704890	hsa-miR-1915-5p	HITS-CLIP	23313552
MIRT704889	hsa-miR-5699-5p	HITS-CLIP	23313552
MIRT704888	hsa-miR-4758-3p	HITS-CLIP	23313552
MIRT704887	hsa-miR-3189-5p	HITS-CLIP	23313552
MIRT268282	hsa-miR-519d-3p	PAR-CLIP	20371350
MIRT005287	hsa-miR-17-5p	PAR-CLIP	20371350
MIRT268274	hsa-miR-20b-5p	PAR-CLIP	20371350
MIRT268279	hsa-miR-526b-3p	PAR-CLIP	20371350
MIRT028002	hsa-miR-93-5p	PAR-CLIP	20371350
MIRT053230	hsa-miR-106a-5p	PAR-CLIP	20371350
MIRT005861	hsa-miR-106b-5p	PAR-CLIP	20371350
MIRT000179	hsa-miR-20a-5p	PAR-CLIP	20371350
MIRT060553	hsa-miR-142-5p	PAR-CLIP	20371350
MIRT060561	hsa-miR-5590-3p	PAR-CLIP	20371350
MIRT060558	hsa-miR-3609	PAR-CLIP	20371350
MIRT060559	hsa-miR-548ah-5p	PAR-CLIP	20371350
MIRT479801	hsa-miR-4796-3p	PAR-CLIP	20371350
MIRT479800	hsa-miR-556-5p	PAR-CLIP	20371350
MIRT060555	hsa-miR-340-5p	PAR-CLIP	20371350
MIRT060556	hsa-miR-448	PAR-CLIP	20371350
MIRT334170	hsa-miR-4781-3p	PAR-CLIP	20371350
MIRT334166	hsa-miR-494-3p	PAR-CLIP	20371350
MIRT479735	hsa-miR-7706	PAR-CLIP	20371350
MIRT512169	hsa-miR-3648	PAR-CLIP	20371350
MIRT512168	hsa-miR-4746-3p	PAR-CLIP	20371350
MIRT479734	hsa-miR-4731-5p	PAR-CLIP	20371350
MIRT479733	hsa-miR-5589-5p	PAR-CLIP	20371350
MIRT334167	hsa-miR-4261	PAR-CLIP	20371350
MIRT479732	hsa-miR-4747-5p	PAR-CLIP	20371350
MIRT479731	hsa-miR-5196-5p	PAR-CLIP	20371350
MIRT479730	hsa-miR-3907	PAR-CLIP	20371350
MIRT334169	hsa-miR-4666a-5p	PAR-CLIP	20371350
MIRT268282	hsa-miR-519d-3p	PAR-CLIP	20371350
MIRT005287	hsa-miR-17-5p	PAR-CLIP	20371350
MIRT268274	hsa-miR-20b-5p	PAR-CLIP	20371350
MIRT268279	hsa-miR-526b-3p	PAR-CLIP	20371350
MIRT028002	hsa-miR-93-5p	PAR-CLIP	20371350
MIRT053230	hsa-miR-106a-5p	PAR-CLIP	20371350
MIRT005861	hsa-miR-106b-5p	PAR-CLIP	20371350
MIRT000179	hsa-miR-20a-5p	PAR-CLIP	20371350
MIRT060553	hsa-miR-142-5p	PAR-CLIP	20371350
MIRT060561	hsa-miR-5590-3p	PAR-CLIP	20371350
MIRT060558	hsa-miR-3609	PAR-CLIP	20371350
MIRT060559	hsa-miR-548ah-5p	PAR-CLIP	20371350
MIRT479801	hsa-miR-4796-3p	PAR-CLIP	20371350
MIRT479800	hsa-miR-556-5p	PAR-CLIP	20371350
MIRT060555	hsa-miR-340-5p	PAR-CLIP	20371350
MIRT060556	hsa-miR-448	PAR-CLIP	20371350
MIRT001105	hsa-miR-503-5p	PAR-CLIP	20371350
MIRT060574	hsa-miR-4694-3p	PAR-CLIP	20371350
MIRT060571	hsa-miR-558	PAR-CLIP	20371350
MIRT479775	hsa-miR-4633-3p	PAR-CLIP	20371350
MIRT479774	hsa-miR-6500-5p	PAR-CLIP	20371350
MIRT479773	hsa-miR-95-3p	PAR-CLIP	20371350
MIRT060579	hsa-miR-6874-5p	PAR-CLIP	20371350
MIRT001105	hsa-miR-503-5p	PAR-CLIP	20371350
MIRT060574	hsa-miR-4694-3p	PAR-CLIP	20371350
MIRT060571	hsa-miR-558	PAR-CLIP	20371350
MIRT479775	hsa-miR-4633-3p	PAR-CLIP	20371350
MIRT479774	hsa-miR-6500-5p	PAR-CLIP	20371350
MIRT479773	hsa-miR-95-3p	PAR-CLIP	20371350
MIRT060579	hsa-miR-6874-5p	PAR-CLIP	20371350
MIRT334170	hsa-miR-4781-3p	PAR-CLIP	20371350
MIRT334165	hsa-miR-204-3p	PAR-CLIP	20371350
MIRT334168	hsa-miR-4646-5p	PAR-CLIP	20371350
MIRT479735	hsa-miR-7706	PAR-CLIP	20371350
MIRT512169	hsa-miR-3648	PAR-CLIP	20371350
MIRT512168	hsa-miR-4746-3p	PAR-CLIP	20371350
MIRT479734	hsa-miR-4731-5p	PAR-CLIP	20371350
MIRT479733	hsa-miR-5589-5p	PAR-CLIP	20371350
MIRT334167	hsa-miR-4261	PAR-CLIP	20371350
MIRT479732	hsa-miR-4747-5p	PAR-CLIP	20371350
MIRT479731	hsa-miR-5196-5p	PAR-CLIP	20371350
MIRT479730	hsa-miR-3907	PAR-CLIP	20371350
MIRT334169	hsa-miR-4666a-5p	PAR-CLIP	20371350
MIRT268282	hsa-miR-519d-3p	PAR-CLIP	20371350
MIRT005287	hsa-miR-17-5p	PAR-CLIP	20371350
MIRT268274	hsa-miR-20b-5p	PAR-CLIP	20371350
MIRT268279	hsa-miR-526b-3p	PAR-CLIP	20371350
MIRT028002	hsa-miR-93-5p	PAR-CLIP	20371350
MIRT053230	hsa-miR-106a-5p	PAR-CLIP	20371350
MIRT005861	hsa-miR-106b-5p	PAR-CLIP	20371350
MIRT000179	hsa-miR-20a-5p	PAR-CLIP	20371350
MIRT060553	hsa-miR-142-5p	PAR-CLIP	20371350
MIRT060561	hsa-miR-5590-3p	PAR-CLIP	20371350
MIRT060558	hsa-miR-3609	PAR-CLIP	20371350
MIRT060559	hsa-miR-548ah-5p	PAR-CLIP	20371350
MIRT479801	hsa-miR-4796-3p	PAR-CLIP	20371350
MIRT479800	hsa-miR-556-5p	PAR-CLIP	20371350
MIRT060555	hsa-miR-340-5p	PAR-CLIP	20371350
MIRT060556	hsa-miR-448	PAR-CLIP	20371350
MIRT001105	hsa-miR-503-5p	PAR-CLIP	20371350
MIRT060574	hsa-miR-4694-3p	PAR-CLIP	20371350
MIRT060571	hsa-miR-558	PAR-CLIP	20371350
MIRT479775	hsa-miR-4633-3p	PAR-CLIP	20371350
MIRT479774	hsa-miR-6500-5p	PAR-CLIP	20371350
MIRT479773	hsa-miR-95-3p	PAR-CLIP	20371350
MIRT060579	hsa-miR-6874-5p	PAR-CLIP	20371350
MIRT502984	hsa-miR-944	PAR-CLIP	20371350
MIRT502983	hsa-miR-369-3p	PAR-CLIP	20371350
MIRT502982	hsa-miR-5692b	PAR-CLIP	20371350
MIRT502981	hsa-miR-5692c	PAR-CLIP	20371350
MIRT268294	hsa-miR-6500-3p	PAR-CLIP	20371350
MIRT502980	hsa-miR-891b	PAR-CLIP	20371350
MIRT241527	hsa-miR-374a-5p	PAR-CLIP	20371350
MIRT016061	hsa-miR-374b-5p	PAR-CLIP	20371350
MIRT268291	hsa-miR-491-3p	PAR-CLIP	20371350
MIRT001105	hsa-miR-503-5p	PAR-CLIP	21572407
MIRT060574	hsa-miR-4694-3p	PAR-CLIP	21572407
MIRT060578	hsa-miR-6748-3p	PAR-CLIP	21572407
MIRT060572	hsa-miR-1234-3p	PAR-CLIP	21572407
MIRT060580	hsa-miR-7107-5p	PAR-CLIP	21572407
MIRT060571	hsa-miR-558	PAR-CLIP	21572407
MIRT060570	hsa-miR-214-5p	PAR-CLIP	21572407
MIRT060576	hsa-miR-1199-3p	PAR-CLIP	21572407
MIRT479775	hsa-miR-4633-3p	PAR-CLIP	21572407
MIRT479774	hsa-miR-6500-5p	PAR-CLIP	21572407
MIRT060577	hsa-miR-6735-3p	PAR-CLIP	21572407
MIRT479773	hsa-miR-95-3p	PAR-CLIP	21572407
MIRT060579	hsa-miR-6874-5p	PAR-CLIP	21572407
MIRT060553	hsa-miR-142-5p	PAR-CLIP	21572407
MIRT060561	hsa-miR-5590-3p	PAR-CLIP	21572407
MIRT060558	hsa-miR-3609	PAR-CLIP	21572407
MIRT060559	hsa-miR-548ah-5p	PAR-CLIP	21572407
MIRT479801	hsa-miR-4796-3p	PAR-CLIP	21572407
MIRT479800	hsa-miR-556-5p	PAR-CLIP	21572407
MIRT060555	hsa-miR-340-5p	PAR-CLIP	21572407
MIRT060556	hsa-miR-448	PAR-CLIP	21572407
MIRT549003	hsa-miR-18a-5p	PAR-CLIP	21572407
MIRT549002	hsa-miR-18b-5p	PAR-CLIP	21572407
MIRT549000	hsa-miR-4735-3p	PAR-CLIP	21572407
MIRT549001	hsa-miR-4789-3p	PAR-CLIP	21572407
MIRT548999	hsa-miR-4643	PAR-CLIP	21572407
MIRT111848	hsa-miR-4691-3p	PAR-CLIP	21572407
MIRT268267	hsa-miR-655-5p	PAR-CLIP	21572407
MIRT548998	hsa-miR-3941	PAR-CLIP	21572407
MIRT548997	hsa-miR-466	PAR-CLIP	21572407
MIRT111846	hsa-miR-3157-5p	PAR-CLIP	21572407
MIRT268268	hsa-miR-4709-3p	PAR-CLIP	21572407
MIRT001105	hsa-miR-503-5p	PAR-CLIP	21572407
MIRT060574	hsa-miR-4694-3p	PAR-CLIP	21572407
MIRT060571	hsa-miR-558	PAR-CLIP	21572407
MIRT479775	hsa-miR-4633-3p	PAR-CLIP	21572407
MIRT479774	hsa-miR-6500-5p	PAR-CLIP	21572407
MIRT479773	hsa-miR-95-3p	PAR-CLIP	21572407
MIRT060579	hsa-miR-6874-5p	PAR-CLIP	21572407
MIRT502984	hsa-miR-944	PAR-CLIP	21572407
MIRT054910	hsa-miR-603	PAR-CLIP	21572407
MIRT502983	hsa-miR-369-3p	PAR-CLIP	21572407
MIRT502982	hsa-miR-5692b	PAR-CLIP	21572407
MIRT502981	hsa-miR-5692c	PAR-CLIP	21572407
MIRT268292	hsa-miR-216b-3p	PAR-CLIP	21572407
MIRT268294	hsa-miR-6500-3p	PAR-CLIP	21572407
MIRT502980	hsa-miR-891b	PAR-CLIP	21572407
MIRT241527	hsa-miR-374a-5p	PAR-CLIP	21572407
MIRT016061	hsa-miR-374b-5p	PAR-CLIP	21572407
MIRT268291	hsa-miR-491-3p	PAR-CLIP	21572407
MIRT268282	hsa-miR-519d-3p	PAR-CLIP	21572407
MIRT005287	hsa-miR-17-5p	PAR-CLIP	21572407
MIRT268274	hsa-miR-20b-5p	PAR-CLIP	21572407
MIRT268279	hsa-miR-526b-3p	PAR-CLIP	21572407
MIRT028002	hsa-miR-93-5p	PAR-CLIP	21572407
MIRT053230	hsa-miR-106a-5p	PAR-CLIP	21572407
MIRT005861	hsa-miR-106b-5p	PAR-CLIP	21572407
MIRT000179	hsa-miR-20a-5p	PAR-CLIP	21572407
MIRT060553	hsa-miR-142-5p	PAR-CLIP	21572407
MIRT060561	hsa-miR-5590-3p	PAR-CLIP	21572407
MIRT060562	hsa-miR-548av-5p	PAR-CLIP	21572407
MIRT060557	hsa-miR-548k	PAR-CLIP	21572407
MIRT060563	hsa-miR-8054	PAR-CLIP	21572407
MIRT060558	hsa-miR-3609	PAR-CLIP	21572407
MIRT060559	hsa-miR-548ah-5p	PAR-CLIP	21572407
MIRT479801	hsa-miR-4796-3p	PAR-CLIP	21572407
MIRT541404	hsa-miR-4797-5p	PAR-CLIP	21572407
MIRT479800	hsa-miR-556-5p	PAR-CLIP	21572407
MIRT060560	hsa-miR-3973	PAR-CLIP	21572407
MIRT246924	hsa-miR-4756-3p	PAR-CLIP	21572407
MIRT246923	hsa-miR-4708-5p	PAR-CLIP	21572407
MIRT060555	hsa-miR-340-5p	PAR-CLIP	21572407
MIRT060556	hsa-miR-448	PAR-CLIP	21572407
MIRT268282	hsa-miR-519d-3p	PAR-CLIP	22012620
MIRT005287	hsa-miR-17-5p	PAR-CLIP	22012620
MIRT268274	hsa-miR-20b-5p	PAR-CLIP	22012620
MIRT268279	hsa-miR-526b-3p	PAR-CLIP	22012620
MIRT028002	hsa-miR-93-5p	PAR-CLIP	22012620
MIRT053230	hsa-miR-106a-5p	PAR-CLIP	22012620
MIRT005861	hsa-miR-106b-5p	PAR-CLIP	22012620
MIRT000179	hsa-miR-20a-5p	PAR-CLIP	22012620
MIRT060553	hsa-miR-142-5p	PAR-CLIP	22012620
MIRT060561	hsa-miR-5590-3p	PAR-CLIP	22012620
MIRT060558	hsa-miR-3609	PAR-CLIP	22012620
MIRT060559	hsa-miR-548ah-5p	PAR-CLIP	22012620
MIRT479801	hsa-miR-4796-3p	PAR-CLIP	22012620
MIRT479800	hsa-miR-556-5p	PAR-CLIP	22012620
MIRT060555	hsa-miR-340-5p	PAR-CLIP	22012620
MIRT060556	hsa-miR-448	PAR-CLIP	22012620
MIRT502984	hsa-miR-944	PAR-CLIP	22012620
MIRT054910	hsa-miR-603	PAR-CLIP	22012620
MIRT502983	hsa-miR-369-3p	PAR-CLIP	22012620
MIRT502982	hsa-miR-5692b	PAR-CLIP	22012620
MIRT502981	hsa-miR-5692c	PAR-CLIP	22012620
MIRT268292	hsa-miR-216b-3p	PAR-CLIP	22012620
MIRT268294	hsa-miR-6500-3p	PAR-CLIP	22012620
MIRT502980	hsa-miR-891b	PAR-CLIP	22012620
MIRT241527	hsa-miR-374a-5p	PAR-CLIP	22012620
MIRT016061	hsa-miR-374b-5p	PAR-CLIP	22012620
MIRT268291	hsa-miR-491-3p	PAR-CLIP	22012620
MIRT060553	hsa-miR-142-5p	PAR-CLIP	23446348
MIRT060561	hsa-miR-5590-3p	PAR-CLIP	23446348
MIRT060558	hsa-miR-3609	PAR-CLIP	23446348
MIRT060559	hsa-miR-548ah-5p	PAR-CLIP	23446348
MIRT479801	hsa-miR-4796-3p	PAR-CLIP	23446348
MIRT479800	hsa-miR-556-5p	PAR-CLIP	23446348
MIRT060555	hsa-miR-340-5p	PAR-CLIP	23446348
MIRT060556	hsa-miR-448	PAR-CLIP	23446348
MIRT502984	hsa-miR-944	PAR-CLIP	23446348
MIRT054910	hsa-miR-603	PAR-CLIP	23446348
MIRT502983	hsa-miR-369-3p	PAR-CLIP	23446348
MIRT502982	hsa-miR-5692b	PAR-CLIP	23446348
MIRT502981	hsa-miR-5692c	PAR-CLIP	23446348
MIRT268292	hsa-miR-216b-3p	PAR-CLIP	23446348
MIRT268294	hsa-miR-6500-3p	PAR-CLIP	23446348
MIRT502980	hsa-miR-891b	PAR-CLIP	23446348
MIRT241527	hsa-miR-374a-5p	PAR-CLIP	23446348
MIRT016061	hsa-miR-374b-5p	PAR-CLIP	23446348
MIRT268282	hsa-miR-519d-3p	PAR-CLIP	23446348
MIRT005287	hsa-miR-17-5p	PAR-CLIP	23446348
MIRT268274	hsa-miR-20b-5p	PAR-CLIP	23446348
MIRT268279	hsa-miR-526b-3p	PAR-CLIP	23446348
MIRT028002	hsa-miR-93-5p	PAR-CLIP	23446348
MIRT053230	hsa-miR-106a-5p	PAR-CLIP	23446348
MIRT005861	hsa-miR-106b-5p	PAR-CLIP	23446348
MIRT000179	hsa-miR-20a-5p	PAR-CLIP	23446348
MIRT060553	hsa-miR-142-5p	PAR-CLIP	23446348
MIRT060561	hsa-miR-5590-3p	PAR-CLIP	23446348
MIRT060558	hsa-miR-3609	PAR-CLIP	23446348
MIRT060559	hsa-miR-548ah-5p	PAR-CLIP	23446348
MIRT479801	hsa-miR-4796-3p	PAR-CLIP	23446348
MIRT479800	hsa-miR-556-5p	PAR-CLIP	23446348
MIRT060555	hsa-miR-340-5p	PAR-CLIP	23446348
MIRT060556	hsa-miR-448	PAR-CLIP	23446348
MIRT334170	hsa-miR-4781-3p	PAR-CLIP	23446348
MIRT512170	hsa-miR-875-3p	PAR-CLIP	23446348
MIRT334166	hsa-miR-494-3p	PAR-CLIP	23446348
MIRT479735	hsa-miR-7706	PAR-CLIP	23446348
MIRT512169	hsa-miR-3648	PAR-CLIP	23446348
MIRT512168	hsa-miR-4746-3p	PAR-CLIP	23446348
MIRT479734	hsa-miR-4731-5p	PAR-CLIP	23446348
MIRT479733	hsa-miR-5589-5p	PAR-CLIP	23446348
MIRT334167	hsa-miR-4261	PAR-CLIP	23446348
MIRT479732	hsa-miR-4747-5p	PAR-CLIP	23446348
MIRT479731	hsa-miR-5196-5p	PAR-CLIP	23446348
MIRT479730	hsa-miR-3907	PAR-CLIP	23446348
MIRT334169	hsa-miR-4666a-5p	PAR-CLIP	23446348
MIRT268282	hsa-miR-519d-3p	PAR-CLIP	24398324
MIRT005287	hsa-miR-17-5p	PAR-CLIP	24398324
MIRT268274	hsa-miR-20b-5p	PAR-CLIP	24398324
MIRT268279	hsa-miR-526b-3p	PAR-CLIP	24398324
MIRT028002	hsa-miR-93-5p	PAR-CLIP	24398324
MIRT053230	hsa-miR-106a-5p	PAR-CLIP	24398324
MIRT005861	hsa-miR-106b-5p	PAR-CLIP	24398324
MIRT000179	hsa-miR-20a-5p	PAR-CLIP	24398324
MIRT060553	hsa-miR-142-5p	PAR-CLIP	24398324
MIRT060561	hsa-miR-5590-3p	PAR-CLIP	24398324
MIRT060558	hsa-miR-3609	PAR-CLIP	24398324
MIRT060559	hsa-miR-548ah-5p	PAR-CLIP	24398324
MIRT479801	hsa-miR-4796-3p	PAR-CLIP	24398324
MIRT479800	hsa-miR-556-5p	PAR-CLIP	24398324
MIRT060555	hsa-miR-340-5p	PAR-CLIP	24398324
MIRT060556	hsa-miR-448	PAR-CLIP	24398324
MIRT001105	hsa-miR-503-5p	PAR-CLIP	24398324
MIRT060574	hsa-miR-4694-3p	PAR-CLIP	24398324
MIRT060578	hsa-miR-6748-3p	PAR-CLIP	24398324
MIRT060572	hsa-miR-1234-3p	PAR-CLIP	24398324
MIRT060580	hsa-miR-7107-5p	PAR-CLIP	24398324
MIRT060571	hsa-miR-558	PAR-CLIP	24398324
MIRT060570	hsa-miR-214-5p	PAR-CLIP	24398324
MIRT060576	hsa-miR-1199-3p	PAR-CLIP	24398324
MIRT479775	hsa-miR-4633-3p	PAR-CLIP	24398324
MIRT479774	hsa-miR-6500-5p	PAR-CLIP	24398324
MIRT060577	hsa-miR-6735-3p	PAR-CLIP	24398324
MIRT479773	hsa-miR-95-3p	PAR-CLIP	24398324
MIRT060579	hsa-miR-6874-5p	PAR-CLIP	24398324
MIRT060587	hsa-miR-6838-5p	PAR-CLIP	24398324
MIRT003913	hsa-miR-15b-5p	PAR-CLIP	24398324
MIRT000225	hsa-miR-195-5p	PAR-CLIP	24398324
MIRT000941	hsa-miR-424-5p	PAR-CLIP	24398324
MIRT001225	hsa-miR-16-5p	PAR-CLIP	24398324
MIRT060581	hsa-miR-497-5p	PAR-CLIP	24398324
MIRT001227	hsa-miR-15a-5p	PAR-CLIP	24398324
MIRT001105	hsa-miR-503-5p	PAR-CLIP	24398324
MIRT060584	hsa-miR-4311	PAR-CLIP	24398324
MIRT060588	hsa-miR-8066	PAR-CLIP	24398324
MIRT502988	hsa-miR-6768-5p	PAR-CLIP	24398324
MIRT502987	hsa-miR-646	PAR-CLIP	24398324
MIRT060583	hsa-miR-545-3p	PAR-CLIP	24398324
MIRT502986	hsa-miR-323b-3p	PAR-CLIP	24398324
MIRT502985	hsa-miR-1257	PAR-CLIP	24398324
MIRT060585	hsa-miR-4672	PAR-CLIP	24398324
MIRT060573	hsa-miR-4524a-5p	PAR-CLIP	24398324
MIRT060575	hsa-miR-4524b-5p	PAR-CLIP	24398324
MIRT246936	hsa-miR-4691-5p	PAR-CLIP	24398324
MIRT246937	hsa-miR-6792-3p	PAR-CLIP	24398324
MIRT502984	hsa-miR-944	PAR-CLIP	24398324
MIRT054910	hsa-miR-603	PAR-CLIP	24398324
MIRT502983	hsa-miR-369-3p	PAR-CLIP	24398324
MIRT502982	hsa-miR-5692b	PAR-CLIP	24398324
MIRT502981	hsa-miR-5692c	PAR-CLIP	24398324
MIRT268292	hsa-miR-216b-3p	PAR-CLIP	24398324
MIRT268294	hsa-miR-6500-3p	PAR-CLIP	24398324
MIRT502980	hsa-miR-891b	PAR-CLIP	24398324
MIRT241527	hsa-miR-374a-5p	PAR-CLIP	24398324
MIRT016061	hsa-miR-374b-5p	PAR-CLIP	24398324
MIRT268291	hsa-miR-491-3p	PAR-CLIP	24398324
MIRT268282	hsa-miR-519d-3p	PAR-CLIP	23592263
MIRT005287	hsa-miR-17-5p	PAR-CLIP	23592263
MIRT268274	hsa-miR-20b-5p	PAR-CLIP	23592263
MIRT268279	hsa-miR-526b-3p	PAR-CLIP	23592263
MIRT028002	hsa-miR-93-5p	PAR-CLIP	23592263
MIRT053230	hsa-miR-106a-5p	PAR-CLIP	23592263
MIRT005861	hsa-miR-106b-5p	PAR-CLIP	23592263
MIRT000179	hsa-miR-20a-5p	PAR-CLIP	23592263
MIRT060553	hsa-miR-142-5p	PAR-CLIP	23592263
MIRT060561	hsa-miR-5590-3p	PAR-CLIP	23592263
MIRT060558	hsa-miR-3609	PAR-CLIP	23592263
MIRT060559	hsa-miR-548ah-5p	PAR-CLIP	23592263
MIRT479801	hsa-miR-4796-3p	PAR-CLIP	23592263
MIRT479800	hsa-miR-556-5p	PAR-CLIP	23592263
MIRT060555	hsa-miR-340-5p	PAR-CLIP	23592263
MIRT060556	hsa-miR-448	PAR-CLIP	23592263
MIRT479799	hsa-miR-21-3p	PAR-CLIP	23592263
MIRT479798	hsa-miR-3591-3p	PAR-CLIP	23592263
MIRT479797	hsa-miR-541-5p	PAR-CLIP	23592263
MIRT479796	hsa-miR-4715-5p	PAR-CLIP	23592263
MIRT479795	hsa-miR-5009-3p	PAR-CLIP	23592263
MIRT479794	hsa-miR-676-5p	PAR-CLIP	23592263
MIRT479793	hsa-miR-145-3p	PAR-CLIP	23592263
MIRT479792	hsa-miR-593-5p	PAR-CLIP	23592263
MIRT024995	hsa-miR-183-5p	PAR-CLIP	23592263
MIRT479791	hsa-miR-1271-5p	PAR-CLIP	23592263
MIRT479790	hsa-miR-96-5p	PAR-CLIP	23592263
MIRT479789	hsa-miR-548an	PAR-CLIP	23592263
MIRT479788	hsa-miR-3714	PAR-CLIP	23592263
MIRT479787	hsa-miR-1910-3p	PAR-CLIP	23592263
MIRT479786	hsa-miR-6511a-5p	PAR-CLIP	23592263
MIRT479785	hsa-miR-4464	PAR-CLIP	23592263
MIRT479784	hsa-miR-4748	PAR-CLIP	23592263
MIRT479783	hsa-miR-298	PAR-CLIP	23592263
MIRT479782	hsa-miR-5087	PAR-CLIP	23592263
MIRT479781	hsa-miR-223-5p	PAR-CLIP	23592263
MIRT479780	hsa-miR-6867-5p	PAR-CLIP	23592263
MIRT479779	hsa-miR-6818-5p	PAR-CLIP	23592263
MIRT479778	hsa-miR-147a	PAR-CLIP	23592263
MIRT479777	hsa-miR-5010-3p	PAR-CLIP	23592263
MIRT479776	hsa-miR-574-5p	PAR-CLIP	23592263
MIRT001105	hsa-miR-503-5p	PAR-CLIP	23592263
MIRT060574	hsa-miR-4694-3p	PAR-CLIP	23592263
MIRT060571	hsa-miR-558	PAR-CLIP	23592263
MIRT479775	hsa-miR-4633-3p	PAR-CLIP	23592263
MIRT479774	hsa-miR-6500-5p	PAR-CLIP	23592263
MIRT479773	hsa-miR-95-3p	PAR-CLIP	23592263
MIRT060579	hsa-miR-6874-5p	PAR-CLIP	23592263
MIRT479772	hsa-miR-5197-3p	PAR-CLIP	23592263
MIRT479771	hsa-miR-6873-5p	PAR-CLIP	23592263
MIRT479770	hsa-miR-9500	PAR-CLIP	23592263
MIRT479768	hsa-miR-7845-5p	PAR-CLIP	23592263
MIRT479769	hsa-miR-518c-5p	PAR-CLIP	23592263
MIRT479767	hsa-miR-326	PAR-CLIP	23592263
MIRT479766	hsa-miR-330-5p	PAR-CLIP	23592263
MIRT479765	hsa-miR-6764-3p	PAR-CLIP	23592263
MIRT479764	hsa-miR-6824-3p	PAR-CLIP	23592263
MIRT479763	hsa-miR-3663-5p	PAR-CLIP	23592263
MIRT479762	hsa-miR-1253	PAR-CLIP	23592263
MIRT479761	hsa-miR-3126-5p	PAR-CLIP	23592263
MIRT479760	hsa-miR-6875-5p	PAR-CLIP	23592263
MIRT479759	hsa-miR-7112-3p	PAR-CLIP	23592263
MIRT060569	hsa-miR-6077	PAR-CLIP	23592263
MIRT334157	hsa-miR-593-3p	PAR-CLIP	23592263
MIRT479758	hsa-miR-513a-5p	PAR-CLIP	23592263
MIRT479757	hsa-miR-3191-5p	PAR-CLIP	23592263
MIRT479756	hsa-miR-6843-3p	PAR-CLIP	23592263
MIRT479755	hsa-miR-6848-3p	PAR-CLIP	23592263
MIRT479754	hsa-miR-4458	PAR-CLIP	23592263
MIRT479753	hsa-let-7i-5p	PAR-CLIP	23592263
MIRT006122	hsa-let-7e-5p	PAR-CLIP	23592263
MIRT479752	hsa-miR-98-5p	PAR-CLIP	23592263
MIRT479751	hsa-miR-4500	PAR-CLIP	23592263
MIRT479750	hsa-let-7d-5p	PAR-CLIP	23592263
MIRT479749	hsa-let-7a-5p	PAR-CLIP	23592263
MIRT032092	hsa-let-7f-5p	PAR-CLIP	23592263
MIRT002484	hsa-let-7b-5p	PAR-CLIP	23592263
MIRT479748	hsa-let-7g-5p	PAR-CLIP	23592263
MIRT479747	hsa-let-7c-5p	PAR-CLIP	23592263
MIRT479746	hsa-miR-2392	PAR-CLIP	23592263
MIRT111856	hsa-miR-758-5p	PAR-CLIP	23592263
MIRT479744	hsa-miR-4537	PAR-CLIP	23592263
MIRT479745	hsa-miR-202-3p	PAR-CLIP	23592263
MIRT479743	hsa-miR-8069	PAR-CLIP	23592263
MIRT479742	hsa-miR-1193	PAR-CLIP	23592263
MIRT479741	hsa-miR-380-5p	PAR-CLIP	23592263
MIRT479740	hsa-miR-563	PAR-CLIP	23592263
MIRT479739	hsa-miR-1299	PAR-CLIP	23592263
MIRT479738	hsa-miR-516b-5p	PAR-CLIP	23592263
MIRT479737	hsa-miR-4782-5p	PAR-CLIP	23592263
MIRT479736	hsa-miR-5706	PAR-CLIP	23592263
MIRT334170	hsa-miR-4781-3p	PAR-CLIP	23592263
MIRT334165	hsa-miR-204-3p	PAR-CLIP	23592263
MIRT334168	hsa-miR-4646-5p	PAR-CLIP	23592263
MIRT479735	hsa-miR-7706	PAR-CLIP	23592263
MIRT479734	hsa-miR-4731-5p	PAR-CLIP	23592263
MIRT479733	hsa-miR-5589-5p	PAR-CLIP	23592263
MIRT334167	hsa-miR-4261	PAR-CLIP	23592263
MIRT479732	hsa-miR-4747-5p	PAR-CLIP	23592263
MIRT479731	hsa-miR-5196-5p	PAR-CLIP	23592263
MIRT479730	hsa-miR-3907	PAR-CLIP	23592263
MIRT334169	hsa-miR-4666a-5p	PAR-CLIP	23592263
MIRT755492	hsa-miR-10b-3p	Luciferase reporter assay, Western blotting, qRT-PCR, In situ hybridization	35236936
MIRT755540	hsa-miR-181c-5p	Western blotting, qRT-PCR	36676955
MIRT502987	hsa-miR-646	Western blotting, qRT-PCR, in vitro cullelar assays, Flow cytometry	37155307
MIRT000480	hsa-miR-193b-3p	Luciferase reporter assay, Western blotting, qRT-PCR	37686289
MIRT871302	hsa-let-7a	CLIP-seq
MIRT871303	hsa-let-7b	CLIP-seq
MIRT871304	hsa-let-7c	CLIP-seq
MIRT871305	hsa-let-7d	CLIP-seq
MIRT871306	hsa-let-7e	CLIP-seq
MIRT871307	hsa-let-7f	CLIP-seq
MIRT871308	hsa-let-7g	CLIP-seq
MIRT871309	hsa-let-7i	CLIP-seq
MIRT871310	hsa-miR-1	CLIP-seq
MIRT871311	hsa-miR-103b	CLIP-seq
MIRT871312	hsa-miR-106a	CLIP-seq
MIRT871313	hsa-miR-106b	CLIP-seq
MIRT871314	hsa-miR-1179	CLIP-seq
MIRT871315	hsa-miR-1183	CLIP-seq
MIRT871316	hsa-miR-1205	CLIP-seq
MIRT871317	hsa-miR-1207-5p	CLIP-seq
MIRT871318	hsa-miR-1225-5p	CLIP-seq
MIRT871319	hsa-miR-1228	CLIP-seq
MIRT871320	hsa-miR-1229	CLIP-seq
MIRT871321	hsa-miR-1234	CLIP-seq
MIRT871322	hsa-miR-1237	CLIP-seq
MIRT871323	hsa-miR-1245b-3p	CLIP-seq
MIRT871324	hsa-miR-1251	CLIP-seq
MIRT871325	hsa-miR-1254	CLIP-seq
MIRT871326	hsa-miR-1266	CLIP-seq
MIRT871327	hsa-miR-1269	CLIP-seq
MIRT871328	hsa-miR-1269b	CLIP-seq
MIRT871329	hsa-miR-1271	CLIP-seq
MIRT871330	hsa-miR-1272	CLIP-seq
MIRT871331	hsa-miR-1273g	CLIP-seq
MIRT871332	hsa-miR-127-5p	CLIP-seq
MIRT871333	hsa-miR-128	CLIP-seq
MIRT871334	hsa-miR-1280	CLIP-seq
MIRT871335	hsa-miR-1281	CLIP-seq
MIRT871336	hsa-miR-1283	CLIP-seq
MIRT871337	hsa-miR-1287	CLIP-seq
MIRT871338	hsa-miR-1288	CLIP-seq
MIRT871339	hsa-miR-1289	CLIP-seq
MIRT871340	hsa-miR-1302	CLIP-seq
MIRT871341	hsa-miR-1322	CLIP-seq
MIRT871342	hsa-miR-1323	CLIP-seq
MIRT871343	hsa-miR-1324	CLIP-seq
MIRT871344	hsa-miR-138	CLIP-seq
MIRT871345	hsa-miR-139-3p	CLIP-seq
MIRT871346	hsa-miR-140-3p	CLIP-seq
MIRT871347	hsa-miR-147	CLIP-seq
MIRT871348	hsa-miR-1471	CLIP-seq
MIRT871349	hsa-miR-150	CLIP-seq
MIRT871350	hsa-miR-1537	CLIP-seq
MIRT871351	hsa-miR-155	CLIP-seq
MIRT871352	hsa-miR-15a	CLIP-seq
MIRT871353	hsa-miR-15b	CLIP-seq
MIRT871354	hsa-miR-16	CLIP-seq
MIRT871355	hsa-miR-17	CLIP-seq
MIRT871356	hsa-miR-186	CLIP-seq
MIRT871357	hsa-miR-187	CLIP-seq
MIRT871358	hsa-miR-18a	CLIP-seq
MIRT871359	hsa-miR-18b	CLIP-seq
MIRT871360	hsa-miR-1908	CLIP-seq
MIRT871361	hsa-miR-1909	CLIP-seq
MIRT871362	hsa-miR-1911	CLIP-seq
MIRT871363	hsa-miR-1913	CLIP-seq
MIRT871364	hsa-miR-193b	CLIP-seq
MIRT871365	hsa-miR-194	CLIP-seq
MIRT871366	hsa-miR-195	CLIP-seq
MIRT871367	hsa-miR-19a	CLIP-seq
MIRT871368	hsa-miR-19b	CLIP-seq
MIRT871369	hsa-miR-202	CLIP-seq
MIRT871370	hsa-miR-204	CLIP-seq
MIRT871371	hsa-miR-2053	CLIP-seq
MIRT871372	hsa-miR-2054	CLIP-seq
MIRT871373	hsa-miR-20a	CLIP-seq
MIRT871374	hsa-miR-20b	CLIP-seq
MIRT871375	hsa-miR-211	CLIP-seq
MIRT871376	hsa-miR-2117	CLIP-seq
MIRT871377	hsa-miR-218	CLIP-seq
MIRT871378	hsa-miR-219-1-3p	CLIP-seq
MIRT871379	hsa-miR-224	CLIP-seq
MIRT871380	hsa-miR-2276	CLIP-seq
MIRT871381	hsa-miR-2278	CLIP-seq
MIRT871382	hsa-miR-23a	CLIP-seq
MIRT871383	hsa-miR-23b	CLIP-seq
MIRT871384	hsa-miR-23c	CLIP-seq
MIRT871385	hsa-miR-302a	CLIP-seq
MIRT871386	hsa-miR-302b	CLIP-seq
MIRT871387	hsa-miR-302c	CLIP-seq
MIRT871388	hsa-miR-302d	CLIP-seq
MIRT871389	hsa-miR-302e	CLIP-seq
MIRT871390	hsa-miR-3064-3p	CLIP-seq
MIRT871391	hsa-miR-3064-5p	CLIP-seq
MIRT871392	hsa-miR-3065-5p	CLIP-seq
MIRT871393	hsa-miR-3116	CLIP-seq
MIRT871394	hsa-miR-3120-3p	CLIP-seq
MIRT871395	hsa-miR-3121-3p	CLIP-seq
MIRT871396	hsa-miR-3121-5p	CLIP-seq
MIRT871397	hsa-miR-3127-3p	CLIP-seq
MIRT871398	hsa-miR-3128	CLIP-seq
MIRT871399	hsa-miR-3132	CLIP-seq
MIRT871400	hsa-miR-3135	CLIP-seq
MIRT871401	hsa-miR-3135b	CLIP-seq
MIRT871402	hsa-miR-3136-3p	CLIP-seq
MIRT871403	hsa-miR-3136-5p	CLIP-seq
MIRT871404	hsa-miR-3137	CLIP-seq
MIRT871405	hsa-miR-3140-3p	CLIP-seq
MIRT871406	hsa-miR-3144-5p	CLIP-seq
MIRT871407	hsa-miR-3151	CLIP-seq
MIRT871408	hsa-miR-3152-3p	CLIP-seq
MIRT871409	hsa-miR-3152-5p	CLIP-seq
MIRT871410	hsa-miR-3160-3p	CLIP-seq
MIRT871411	hsa-miR-3162-3p	CLIP-seq
MIRT871412	hsa-miR-3163	CLIP-seq
MIRT871413	hsa-miR-3164	CLIP-seq
MIRT871414	hsa-miR-3175	CLIP-seq
MIRT871415	hsa-miR-3176	CLIP-seq
MIRT871416	hsa-miR-3180	CLIP-seq
MIRT871417	hsa-miR-3180-3p	CLIP-seq
MIRT871418	hsa-miR-3180-5p	CLIP-seq
MIRT871419	hsa-miR-3182	CLIP-seq
MIRT871420	hsa-miR-3183	CLIP-seq
MIRT871421	hsa-miR-3185	CLIP-seq
MIRT871422	hsa-miR-3186-3p	CLIP-seq
MIRT871423	hsa-miR-3191	CLIP-seq
MIRT871424	hsa-miR-3192	CLIP-seq
MIRT871425	hsa-miR-3196	CLIP-seq
MIRT871426	hsa-miR-3198	CLIP-seq
MIRT871427	hsa-miR-3201	CLIP-seq
MIRT871428	hsa-miR-323-3p	CLIP-seq
MIRT871429	hsa-miR-323-5p	CLIP-seq
MIRT871430	hsa-miR-324-3p	CLIP-seq
MIRT871431	hsa-miR-329	CLIP-seq
MIRT871432	hsa-miR-330-3p	CLIP-seq
MIRT871433	hsa-miR-33a	CLIP-seq
MIRT871434	hsa-miR-33b	CLIP-seq
MIRT871435	hsa-miR-340	CLIP-seq
MIRT871436	hsa-miR-342-3p	CLIP-seq
MIRT871437	hsa-miR-346	CLIP-seq
MIRT871438	hsa-miR-34a	CLIP-seq
MIRT871439	hsa-miR-34b	CLIP-seq
MIRT871440	hsa-miR-3607-3p	CLIP-seq
MIRT871441	hsa-miR-3611	CLIP-seq
MIRT871442	hsa-miR-3613-3p	CLIP-seq
MIRT871443	hsa-miR-361-3p	CLIP-seq
MIRT871444	hsa-miR-3614-3p	CLIP-seq
MIRT871445	hsa-miR-361-5p	CLIP-seq
MIRT871446	hsa-miR-3616-5p	CLIP-seq
MIRT871447	hsa-miR-3617	CLIP-seq
MIRT871448	hsa-miR-362-3p	CLIP-seq
MIRT871449	hsa-miR-3647-5p	CLIP-seq
MIRT871450	hsa-miR-365	CLIP-seq
MIRT871451	hsa-miR-3652	CLIP-seq
MIRT871452	hsa-miR-3662	CLIP-seq
MIRT871453	hsa-miR-3669	CLIP-seq
MIRT871454	hsa-miR-3673	CLIP-seq
MIRT871455	hsa-miR-3677-5p	CLIP-seq
MIRT871456	hsa-miR-3685	CLIP-seq
MIRT871457	hsa-miR-3686	CLIP-seq
MIRT871458	hsa-miR-3690	CLIP-seq
MIRT871459	hsa-miR-370	CLIP-seq
MIRT871460	hsa-miR-371b-3p	CLIP-seq
MIRT871461	hsa-miR-372	CLIP-seq
MIRT871462	hsa-miR-373	CLIP-seq
MIRT871463	hsa-miR-374a	CLIP-seq
MIRT871464	hsa-miR-374b	CLIP-seq
MIRT871465	hsa-miR-374c	CLIP-seq
MIRT871466	hsa-miR-376c	CLIP-seq
MIRT871467	hsa-miR-383	CLIP-seq
MIRT871468	hsa-miR-384	CLIP-seq
MIRT871469	hsa-miR-3909	CLIP-seq
MIRT871470	hsa-miR-3910	CLIP-seq
MIRT871471	hsa-miR-3911	CLIP-seq
MIRT871472	hsa-miR-3918	CLIP-seq
MIRT871473	hsa-miR-3921	CLIP-seq
MIRT871474	hsa-miR-3922-3p	CLIP-seq
MIRT871475	hsa-miR-3923	CLIP-seq
MIRT871476	hsa-miR-3929	CLIP-seq
MIRT871477	hsa-miR-3938	CLIP-seq
MIRT871478	hsa-miR-3978	CLIP-seq
MIRT871479	hsa-miR-421	CLIP-seq
MIRT871480	hsa-miR-424	CLIP-seq
MIRT871481	hsa-miR-425	CLIP-seq
MIRT871482	hsa-miR-4258	CLIP-seq
MIRT871483	hsa-miR-4263	CLIP-seq
MIRT871484	hsa-miR-4265	CLIP-seq
MIRT871485	hsa-miR-4273	CLIP-seq
MIRT871486	hsa-miR-4286	CLIP-seq
MIRT871487	hsa-miR-4287	CLIP-seq
MIRT871488	hsa-miR-4288	CLIP-seq
MIRT871489	hsa-miR-4290	CLIP-seq
MIRT871490	hsa-miR-4294	CLIP-seq
MIRT871491	hsa-miR-4296	CLIP-seq
MIRT871492	hsa-miR-4298	CLIP-seq
MIRT871493	hsa-miR-4301	CLIP-seq
MIRT871494	hsa-miR-4305	CLIP-seq
MIRT871495	hsa-miR-4307	CLIP-seq
MIRT871496	hsa-miR-4309	CLIP-seq
MIRT871497	hsa-miR-4314	CLIP-seq
MIRT871498	hsa-miR-4322	CLIP-seq
MIRT871499	hsa-miR-4327	CLIP-seq
MIRT871500	hsa-miR-4328	CLIP-seq
MIRT871501	hsa-miR-4417	CLIP-seq
MIRT871502	hsa-miR-4419b	CLIP-seq
MIRT871503	hsa-miR-4428	CLIP-seq
MIRT871504	hsa-miR-4430	CLIP-seq
MIRT871505	hsa-miR-4436a	CLIP-seq
MIRT871506	hsa-miR-4438	CLIP-seq
MIRT871507	hsa-miR-4439	CLIP-seq
MIRT871508	hsa-miR-4446-5p	CLIP-seq
MIRT871509	hsa-miR-4461	CLIP-seq
MIRT871510	hsa-miR-4469	CLIP-seq
MIRT871511	hsa-miR-4476	CLIP-seq
MIRT871512	hsa-miR-4478	CLIP-seq
MIRT871513	hsa-miR-4481	CLIP-seq
MIRT871514	hsa-miR-4487	CLIP-seq
MIRT871515	hsa-miR-4490	CLIP-seq
MIRT871516	hsa-miR-4494	CLIP-seq
MIRT871517	hsa-miR-449b	CLIP-seq
MIRT871518	hsa-miR-4505	CLIP-seq
MIRT871519	hsa-miR-4507	CLIP-seq
MIRT871520	hsa-miR-4508	CLIP-seq
MIRT871521	hsa-miR-450b-3p	CLIP-seq
MIRT871522	hsa-miR-4514	CLIP-seq
MIRT871523	hsa-miR-4515	CLIP-seq
MIRT871524	hsa-miR-4517	CLIP-seq
MIRT871525	hsa-miR-4518	CLIP-seq
MIRT871526	hsa-miR-4522	CLIP-seq
MIRT871527	hsa-miR-4524	CLIP-seq
MIRT871528	hsa-miR-4529-3p	CLIP-seq
MIRT871529	hsa-miR-4632	CLIP-seq
MIRT871530	hsa-miR-4648	CLIP-seq
MIRT871531	hsa-miR-4649-3p	CLIP-seq
MIRT871532	hsa-miR-4650-3p	CLIP-seq
MIRT871533	hsa-miR-4652-5p	CLIP-seq
MIRT871534	hsa-miR-4653-5p	CLIP-seq
MIRT871535	hsa-miR-4654	CLIP-seq
MIRT871536	hsa-miR-4655-5p	CLIP-seq
MIRT871537	hsa-miR-4659a-3p	CLIP-seq
MIRT871538	hsa-miR-4659b-3p	CLIP-seq
MIRT871539	hsa-miR-4662a-3p	CLIP-seq
MIRT871540	hsa-miR-4662a-5p	CLIP-seq
MIRT871541	hsa-miR-4664-3p	CLIP-seq
MIRT871542	hsa-miR-4666-3p	CLIP-seq
MIRT871543	hsa-miR-4666-5p	CLIP-seq
MIRT871544	hsa-miR-4667-3p	CLIP-seq
MIRT871545	hsa-miR-4667-5p	CLIP-seq
MIRT871546	hsa-miR-4668-3p	CLIP-seq
MIRT871547	hsa-miR-4668-5p	CLIP-seq
MIRT871548	hsa-miR-4677-3p	CLIP-seq
MIRT871549	hsa-miR-4678	CLIP-seq
MIRT871550	hsa-miR-4680-3p	CLIP-seq
MIRT871551	hsa-miR-4684-5p	CLIP-seq
MIRT871552	hsa-miR-4685-3p	CLIP-seq
MIRT871553	hsa-miR-4688	CLIP-seq
MIRT871554	hsa-miR-4690-5p	CLIP-seq
MIRT871555	hsa-miR-4692	CLIP-seq
MIRT871556	hsa-miR-4693-3p	CLIP-seq
MIRT871557	hsa-miR-4698	CLIP-seq
MIRT871558	hsa-miR-4700-3p	CLIP-seq
MIRT871559	hsa-miR-4700-5p	CLIP-seq
MIRT871560	hsa-miR-4704-5p	CLIP-seq
MIRT871561	hsa-miR-4707-3p	CLIP-seq
MIRT871562	hsa-miR-4707-5p	CLIP-seq
MIRT871563	hsa-miR-4712-3p	CLIP-seq
MIRT871564	hsa-miR-4713-3p	CLIP-seq
MIRT871565	hsa-miR-4715-3p	CLIP-seq
MIRT871566	hsa-miR-4723-3p	CLIP-seq
MIRT871567	hsa-miR-4725-5p	CLIP-seq
MIRT871568	hsa-miR-4729	CLIP-seq
MIRT871569	hsa-miR-4735-5p	CLIP-seq
MIRT871570	hsa-miR-4740-3p	CLIP-seq
MIRT871571	hsa-miR-4740-5p	CLIP-seq
MIRT871572	hsa-miR-4742-3p	CLIP-seq
MIRT871573	hsa-miR-4745-5p	CLIP-seq
MIRT871574	hsa-miR-4753-3p	CLIP-seq
MIRT871575	hsa-miR-4755-5p	CLIP-seq
MIRT871576	hsa-miR-4757-5p	CLIP-seq
MIRT871577	hsa-miR-4760-3p	CLIP-seq
MIRT871578	hsa-miR-4763-3p	CLIP-seq
MIRT871579	hsa-miR-4766-5p	CLIP-seq
MIRT871580	hsa-miR-4768-5p	CLIP-seq
MIRT871581	hsa-miR-4769-5p	CLIP-seq
MIRT871582	hsa-miR-4772-3p	CLIP-seq
MIRT871583	hsa-miR-4774-5p	CLIP-seq
MIRT871584	hsa-miR-4775	CLIP-seq
MIRT871585	hsa-miR-4777-5p	CLIP-seq
MIRT871586	hsa-miR-4778-3p	CLIP-seq
MIRT871587	hsa-miR-4783-3p	CLIP-seq
MIRT871588	hsa-miR-4790-3p	CLIP-seq
MIRT871589	hsa-miR-4791	CLIP-seq
MIRT871590	hsa-miR-4793-5p	CLIP-seq
MIRT871591	hsa-miR-4795-5p	CLIP-seq
MIRT871592	hsa-miR-4796-5p	CLIP-seq
MIRT871593	hsa-miR-4802-3p	CLIP-seq
MIRT871594	hsa-miR-487a	CLIP-seq
MIRT871595	hsa-miR-487b	CLIP-seq
MIRT871596	hsa-miR-490-5p	CLIP-seq
MIRT871597	hsa-miR-494	CLIP-seq
MIRT871598	hsa-miR-495	CLIP-seq
MIRT871599	hsa-miR-497	CLIP-seq
MIRT871600	hsa-miR-499a-5p	CLIP-seq
MIRT871601	hsa-miR-500a	CLIP-seq
MIRT871602	hsa-miR-503	CLIP-seq
MIRT871603	hsa-miR-504	CLIP-seq
MIRT871604	hsa-miR-511	CLIP-seq
MIRT871605	hsa-miR-516b	CLIP-seq
MIRT871606	hsa-miR-518a-5p	CLIP-seq
MIRT871607	hsa-miR-518d-5p	CLIP-seq
MIRT871608	hsa-miR-519b-5p	CLIP-seq
MIRT871609	hsa-miR-519c-5p	CLIP-seq
MIRT871610	hsa-miR-519d	CLIP-seq
MIRT871611	hsa-miR-520a-5p	CLIP-seq
MIRT871612	hsa-miR-520c-3p	CLIP-seq
MIRT871613	hsa-miR-520c-5p	CLIP-seq
MIRT871614	hsa-miR-520e	CLIP-seq
MIRT871615	hsa-miR-520f	CLIP-seq
MIRT871616	hsa-miR-520g	CLIP-seq
MIRT871617	hsa-miR-520h	CLIP-seq
MIRT871618	hsa-miR-522	CLIP-seq
MIRT871619	hsa-miR-525-5p	CLIP-seq
MIRT871620	hsa-miR-526a	CLIP-seq
MIRT871621	hsa-miR-526b	CLIP-seq
MIRT871622	hsa-miR-527	CLIP-seq
MIRT871623	hsa-miR-545	CLIP-seq
MIRT871624	hsa-miR-548a-3p	CLIP-seq
MIRT871625	hsa-miR-548aa	CLIP-seq
MIRT871626	hsa-miR-548ac	CLIP-seq
MIRT871627	hsa-miR-548ad	CLIP-seq
MIRT871628	hsa-miR-548ae	CLIP-seq
MIRT871629	hsa-miR-548ah	CLIP-seq
MIRT871630	hsa-miR-548aj	CLIP-seq
MIRT871631	hsa-miR-548am	CLIP-seq
MIRT871632	hsa-miR-548c-3p	CLIP-seq
MIRT871633	hsa-miR-548d-3p	CLIP-seq
MIRT871634	hsa-miR-548e	CLIP-seq
MIRT871635	hsa-miR-548f	CLIP-seq
MIRT871636	hsa-miR-548g	CLIP-seq
MIRT871637	hsa-miR-548o	CLIP-seq
MIRT871638	hsa-miR-548q	CLIP-seq
MIRT871639	hsa-miR-548u	CLIP-seq
MIRT871640	hsa-miR-548x	CLIP-seq
MIRT871641	hsa-miR-548z	CLIP-seq
MIRT871642	hsa-miR-550a	CLIP-seq
MIRT871643	hsa-miR-552	CLIP-seq
MIRT871644	hsa-miR-555	CLIP-seq
MIRT871645	hsa-miR-562	CLIP-seq
MIRT871646	hsa-miR-564	CLIP-seq
MIRT871647	hsa-miR-569	CLIP-seq
MIRT871648	hsa-miR-573	CLIP-seq
MIRT871649	hsa-miR-580	CLIP-seq
MIRT871650	hsa-miR-584	CLIP-seq
MIRT871651	hsa-miR-587	CLIP-seq
MIRT871652	hsa-miR-590-3p	CLIP-seq
MIRT871653	hsa-miR-593	CLIP-seq
MIRT871654	hsa-miR-599	CLIP-seq
MIRT871655	hsa-miR-600	CLIP-seq
MIRT871656	hsa-miR-602	CLIP-seq
MIRT871657	hsa-miR-604	CLIP-seq
MIRT871658	hsa-miR-606	CLIP-seq
MIRT871659	hsa-miR-607	CLIP-seq
MIRT871660	hsa-miR-613	CLIP-seq
MIRT871661	hsa-miR-617	CLIP-seq
MIRT871662	hsa-miR-619	CLIP-seq
MIRT871663	hsa-miR-623	CLIP-seq
MIRT871664	hsa-miR-625	CLIP-seq
MIRT871665	hsa-miR-628-5p	CLIP-seq
MIRT871666	hsa-miR-632	CLIP-seq
MIRT871667	hsa-miR-634	CLIP-seq
MIRT871668	hsa-miR-636	CLIP-seq
MIRT871669	hsa-miR-637	CLIP-seq
MIRT871670	hsa-miR-638	CLIP-seq
MIRT871671	hsa-miR-641	CLIP-seq
MIRT871672	hsa-miR-644	CLIP-seq
MIRT871673	hsa-miR-647	CLIP-seq
MIRT871674	hsa-miR-655	CLIP-seq
MIRT871675	hsa-miR-656	CLIP-seq
MIRT871676	hsa-miR-661	CLIP-seq
MIRT871677	hsa-miR-663	CLIP-seq
MIRT871678	hsa-miR-663b	CLIP-seq
MIRT871679	hsa-miR-668	CLIP-seq
MIRT871680	hsa-miR-769-3p	CLIP-seq
MIRT871681	hsa-miR-873	CLIP-seq
MIRT871682	hsa-miR-885-5p	CLIP-seq
MIRT871683	hsa-miR-889	CLIP-seq
MIRT871684	hsa-miR-93	CLIP-seq
MIRT871685	hsa-miR-938	CLIP-seq
MIRT871686	hsa-miR-942	CLIP-seq
MIRT871687	hsa-miR-943	CLIP-seq
MIRT871688	hsa-miR-95	CLIP-seq
MIRT871689	hsa-miR-96	CLIP-seq
MIRT871690	hsa-miR-98	CLIP-seq
MIRT871314	hsa-miR-1179	CLIP-seq
MIRT871336	hsa-miR-1283	CLIP-seq
MIRT871339	hsa-miR-1289	CLIP-seq
MIRT871352	hsa-miR-15a	CLIP-seq
MIRT871353	hsa-miR-15b	CLIP-seq
MIRT871354	hsa-miR-16	CLIP-seq
MIRT871366	hsa-miR-195	CLIP-seq
MIRT871379	hsa-miR-224	CLIP-seq
MIRT871381	hsa-miR-2278	CLIP-seq
MIRT871382	hsa-miR-23a	CLIP-seq
MIRT871383	hsa-miR-23b	CLIP-seq
MIRT871384	hsa-miR-23c	CLIP-seq
MIRT871412	hsa-miR-3163	CLIP-seq
MIRT871426	hsa-miR-3198	CLIP-seq
MIRT871433	hsa-miR-33a	CLIP-seq
MIRT871434	hsa-miR-33b	CLIP-seq
MIRT871435	hsa-miR-340	CLIP-seq
MIRT871439	hsa-miR-34b	CLIP-seq
MIRT871453	hsa-miR-3669	CLIP-seq
MIRT871454	hsa-miR-3673	CLIP-seq
MIRT871463	hsa-miR-374a	CLIP-seq
MIRT871464	hsa-miR-374b	CLIP-seq
MIRT871480	hsa-miR-424	CLIP-seq
MIRT871490	hsa-miR-4294	CLIP-seq
MIRT871496	hsa-miR-4309	CLIP-seq
MIRT871511	hsa-miR-4476	CLIP-seq
MIRT871527	hsa-miR-4524	CLIP-seq
MIRT871529	hsa-miR-4632	CLIP-seq
MIRT871542	hsa-miR-4666-3p	CLIP-seq
MIRT871557	hsa-miR-4698	CLIP-seq
MIRT871561	hsa-miR-4707-3p	CLIP-seq
MIRT871568	hsa-miR-4729	CLIP-seq
MIRT871574	hsa-miR-4753-3p	CLIP-seq
MIRT871594	hsa-miR-487a	CLIP-seq
MIRT871599	hsa-miR-497	CLIP-seq
MIRT871602	hsa-miR-503	CLIP-seq
MIRT871623	hsa-miR-545	CLIP-seq
MIRT871624	hsa-miR-548a-3p	CLIP-seq
MIRT871628	hsa-miR-548ae	CLIP-seq
MIRT871630	hsa-miR-548aj	CLIP-seq
MIRT871631	hsa-miR-548am	CLIP-seq
MIRT871632	hsa-miR-548c-3p	CLIP-seq
MIRT871634	hsa-miR-548e	CLIP-seq
MIRT871635	hsa-miR-548f	CLIP-seq
MIRT871640	hsa-miR-548x	CLIP-seq
MIRT871418	hsa-miR-3180-5p	CLIP-seq
MIRT871440	hsa-miR-3607-3p	CLIP-seq
MIRT871626	hsa-miR-548ac	CLIP-seq
MIRT871628	hsa-miR-548ae	CLIP-seq
MIRT871630	hsa-miR-548aj	CLIP-seq
MIRT871631	hsa-miR-548am	CLIP-seq
MIRT871633	hsa-miR-548d-3p	CLIP-seq
MIRT871640	hsa-miR-548x	CLIP-seq
MIRT871641	hsa-miR-548z	CLIP-seq
MIRT871658	hsa-miR-606	CLIP-seq
MIRT871628	hsa-miR-548ae	CLIP-seq
MIRT871630	hsa-miR-548aj	CLIP-seq
MIRT871631	hsa-miR-548am	CLIP-seq
MIRT871640	hsa-miR-548x	CLIP-seq
MIRT871302	hsa-let-7a	CLIP-seq
MIRT871303	hsa-let-7b	CLIP-seq
MIRT871304	hsa-let-7c	CLIP-seq
MIRT871305	hsa-let-7d	CLIP-seq
MIRT871306	hsa-let-7e	CLIP-seq
MIRT871307	hsa-let-7f	CLIP-seq
MIRT871308	hsa-let-7g	CLIP-seq
MIRT871309	hsa-let-7i	CLIP-seq
MIRT871310	hsa-miR-1	CLIP-seq
MIRT871311	hsa-miR-103b	CLIP-seq
MIRT871312	hsa-miR-106a	CLIP-seq
MIRT871313	hsa-miR-106b	CLIP-seq
MIRT871314	hsa-miR-1179	CLIP-seq
MIRT871315	hsa-miR-1183	CLIP-seq
MIRT871316	hsa-miR-1205	CLIP-seq
MIRT871317	hsa-miR-1207-5p	CLIP-seq
MIRT1958687	hsa-miR-1224-3p	CLIP-seq
MIRT871318	hsa-miR-1225-5p	CLIP-seq
MIRT1958688	hsa-miR-1226	CLIP-seq
MIRT871320	hsa-miR-1229	CLIP-seq
MIRT871321	hsa-miR-1234	CLIP-seq
MIRT871323	hsa-miR-1245b-3p	CLIP-seq
MIRT871325	hsa-miR-1254	CLIP-seq
MIRT871326	hsa-miR-1266	CLIP-seq
MIRT871327	hsa-miR-1269	CLIP-seq
MIRT871328	hsa-miR-1269b	CLIP-seq
MIRT871329	hsa-miR-1271	CLIP-seq
MIRT871330	hsa-miR-1272	CLIP-seq
MIRT871331	hsa-miR-1273g	CLIP-seq
MIRT871333	hsa-miR-128	CLIP-seq
MIRT871334	hsa-miR-1280	CLIP-seq
MIRT871335	hsa-miR-1281	CLIP-seq
MIRT871336	hsa-miR-1283	CLIP-seq
MIRT871337	hsa-miR-1287	CLIP-seq
MIRT871338	hsa-miR-1288	CLIP-seq
MIRT871339	hsa-miR-1289	CLIP-seq
MIRT871340	hsa-miR-1302	CLIP-seq
MIRT871341	hsa-miR-1322	CLIP-seq
MIRT871342	hsa-miR-1323	CLIP-seq
MIRT871343	hsa-miR-1324	CLIP-seq
MIRT871344	hsa-miR-138	CLIP-seq
MIRT871345	hsa-miR-139-3p	CLIP-seq
MIRT871346	hsa-miR-140-3p	CLIP-seq
MIRT871347	hsa-miR-147	CLIP-seq
MIRT871348	hsa-miR-1471	CLIP-seq
MIRT871349	hsa-miR-150	CLIP-seq
MIRT871350	hsa-miR-1537	CLIP-seq
MIRT871351	hsa-miR-155	CLIP-seq
MIRT871352	hsa-miR-15a	CLIP-seq
MIRT871353	hsa-miR-15b	CLIP-seq
MIRT871354	hsa-miR-16	CLIP-seq
MIRT871355	hsa-miR-17	CLIP-seq
MIRT871356	hsa-miR-186	CLIP-seq
MIRT871357	hsa-miR-187	CLIP-seq
MIRT871358	hsa-miR-18a	CLIP-seq
MIRT871359	hsa-miR-18b	CLIP-seq
MIRT871360	hsa-miR-1908	CLIP-seq
MIRT871361	hsa-miR-1909	CLIP-seq
MIRT871362	hsa-miR-1911	CLIP-seq
MIRT871363	hsa-miR-1913	CLIP-seq
MIRT1958689	hsa-miR-1914	CLIP-seq
MIRT871364	hsa-miR-193b	CLIP-seq
MIRT871365	hsa-miR-194	CLIP-seq
MIRT871366	hsa-miR-195	CLIP-seq
MIRT1958690	hsa-miR-1973	CLIP-seq
MIRT871367	hsa-miR-19a	CLIP-seq
MIRT871368	hsa-miR-19b	CLIP-seq
MIRT871369	hsa-miR-202	CLIP-seq
MIRT871371	hsa-miR-2053	CLIP-seq
MIRT871372	hsa-miR-2054	CLIP-seq
MIRT871373	hsa-miR-20a	CLIP-seq
MIRT871374	hsa-miR-20b	CLIP-seq
MIRT871377	hsa-miR-218	CLIP-seq
MIRT871378	hsa-miR-219-1-3p	CLIP-seq
MIRT871379	hsa-miR-224	CLIP-seq
MIRT871380	hsa-miR-2276	CLIP-seq
MIRT871381	hsa-miR-2278	CLIP-seq
MIRT871382	hsa-miR-23a	CLIP-seq
MIRT871383	hsa-miR-23b	CLIP-seq
MIRT871384	hsa-miR-23c	CLIP-seq
MIRT871385	hsa-miR-302a	CLIP-seq
MIRT871386	hsa-miR-302b	CLIP-seq
MIRT871387	hsa-miR-302c	CLIP-seq
MIRT871388	hsa-miR-302d	CLIP-seq
MIRT871389	hsa-miR-302e	CLIP-seq
MIRT871390	hsa-miR-3064-3p	CLIP-seq
MIRT871391	hsa-miR-3064-5p	CLIP-seq
MIRT871392	hsa-miR-3065-5p	CLIP-seq
MIRT871393	hsa-miR-3116	CLIP-seq
MIRT871394	hsa-miR-3120-3p	CLIP-seq
MIRT871395	hsa-miR-3121-3p	CLIP-seq
MIRT871396	hsa-miR-3121-5p	CLIP-seq
MIRT871398	hsa-miR-3128	CLIP-seq
MIRT871399	hsa-miR-3132	CLIP-seq
MIRT1958691	hsa-miR-3133	CLIP-seq
MIRT871400	hsa-miR-3135	CLIP-seq
MIRT871401	hsa-miR-3135b	CLIP-seq
MIRT871402	hsa-miR-3136-3p	CLIP-seq
MIRT871403	hsa-miR-3136-5p	CLIP-seq
MIRT871404	hsa-miR-3137	CLIP-seq
MIRT871405	hsa-miR-3140-3p	CLIP-seq
MIRT871406	hsa-miR-3144-5p	CLIP-seq
MIRT871407	hsa-miR-3151	CLIP-seq
MIRT871408	hsa-miR-3152-3p	CLIP-seq
MIRT871409	hsa-miR-3152-5p	CLIP-seq
MIRT871410	hsa-miR-3160-3p	CLIP-seq
MIRT871412	hsa-miR-3163	CLIP-seq
MIRT871413	hsa-miR-3164	CLIP-seq
MIRT871414	hsa-miR-3175	CLIP-seq
MIRT871415	hsa-miR-3176	CLIP-seq
MIRT871416	hsa-miR-3180	CLIP-seq
MIRT871417	hsa-miR-3180-3p	CLIP-seq
MIRT871418	hsa-miR-3180-5p	CLIP-seq
MIRT871419	hsa-miR-3182	CLIP-seq
MIRT871420	hsa-miR-3183	CLIP-seq
MIRT871421	hsa-miR-3185	CLIP-seq
MIRT871422	hsa-miR-3186-3p	CLIP-seq
MIRT871423	hsa-miR-3191	CLIP-seq
MIRT871424	hsa-miR-3192	CLIP-seq
MIRT871425	hsa-miR-3196	CLIP-seq
MIRT871426	hsa-miR-3198	CLIP-seq
MIRT871427	hsa-miR-3201	CLIP-seq
MIRT871428	hsa-miR-323-3p	CLIP-seq
MIRT871429	hsa-miR-323-5p	CLIP-seq
MIRT871430	hsa-miR-324-3p	CLIP-seq
MIRT871431	hsa-miR-329	CLIP-seq
MIRT871432	hsa-miR-330-3p	CLIP-seq
MIRT871433	hsa-miR-33a	CLIP-seq
MIRT871434	hsa-miR-33b	CLIP-seq
MIRT871435	hsa-miR-340	CLIP-seq
MIRT871436	hsa-miR-342-3p	CLIP-seq
MIRT871437	hsa-miR-346	CLIP-seq
MIRT871438	hsa-miR-34a	CLIP-seq
MIRT871439	hsa-miR-34b	CLIP-seq
MIRT871440	hsa-miR-3607-3p	CLIP-seq
MIRT871441	hsa-miR-3611	CLIP-seq
MIRT871442	hsa-miR-3613-3p	CLIP-seq
MIRT871443	hsa-miR-361-3p	CLIP-seq
MIRT871445	hsa-miR-361-5p	CLIP-seq
MIRT871446	hsa-miR-3616-5p	CLIP-seq
MIRT871447	hsa-miR-3617	CLIP-seq
MIRT871448	hsa-miR-362-3p	CLIP-seq
MIRT871449	hsa-miR-3647-5p	CLIP-seq
MIRT871450	hsa-miR-365	CLIP-seq
MIRT871451	hsa-miR-3652	CLIP-seq
MIRT871453	hsa-miR-3669	CLIP-seq
MIRT871454	hsa-miR-3673	CLIP-seq
MIRT871455	hsa-miR-3677-5p	CLIP-seq
MIRT871456	hsa-miR-3685	CLIP-seq
MIRT871457	hsa-miR-3686	CLIP-seq
MIRT871458	hsa-miR-3690	CLIP-seq
MIRT871459	hsa-miR-370	CLIP-seq
MIRT871460	hsa-miR-371b-3p	CLIP-seq
MIRT871461	hsa-miR-372	CLIP-seq
MIRT871462	hsa-miR-373	CLIP-seq
MIRT871463	hsa-miR-374a	CLIP-seq
MIRT871464	hsa-miR-374b	CLIP-seq
MIRT871465	hsa-miR-374c	CLIP-seq
MIRT871466	hsa-miR-376c	CLIP-seq
MIRT871467	hsa-miR-383	CLIP-seq
MIRT871468	hsa-miR-384	CLIP-seq
MIRT871469	hsa-miR-3909	CLIP-seq
MIRT871471	hsa-miR-3911	CLIP-seq
MIRT871472	hsa-miR-3918	CLIP-seq
MIRT871474	hsa-miR-3922-3p	CLIP-seq
MIRT871475	hsa-miR-3923	CLIP-seq
MIRT871476	hsa-miR-3929	CLIP-seq
MIRT871477	hsa-miR-3938	CLIP-seq
MIRT871478	hsa-miR-3978	CLIP-seq
MIRT871479	hsa-miR-421	CLIP-seq
MIRT871480	hsa-miR-424	CLIP-seq
MIRT871481	hsa-miR-425	CLIP-seq
MIRT871482	hsa-miR-4258	CLIP-seq
MIRT871483	hsa-miR-4263	CLIP-seq
MIRT871484	hsa-miR-4265	CLIP-seq
MIRT871486	hsa-miR-4286	CLIP-seq
MIRT871487	hsa-miR-4287	CLIP-seq
MIRT871488	hsa-miR-4288	CLIP-seq
MIRT871489	hsa-miR-4290	CLIP-seq
MIRT871490	hsa-miR-4294	CLIP-seq
MIRT871491	hsa-miR-4296	CLIP-seq
MIRT871492	hsa-miR-4298	CLIP-seq
MIRT871493	hsa-miR-4301	CLIP-seq
MIRT871494	hsa-miR-4305	CLIP-seq
MIRT871495	hsa-miR-4307	CLIP-seq
MIRT871496	hsa-miR-4309	CLIP-seq
MIRT871497	hsa-miR-4314	CLIP-seq
MIRT871498	hsa-miR-4322	CLIP-seq
MIRT1958692	hsa-miR-4325	CLIP-seq
MIRT871499	hsa-miR-4327	CLIP-seq
MIRT871500	hsa-miR-4328	CLIP-seq
MIRT871501	hsa-miR-4417	CLIP-seq
MIRT871502	hsa-miR-4419b	CLIP-seq
MIRT871503	hsa-miR-4428	CLIP-seq
MIRT871504	hsa-miR-4430	CLIP-seq
MIRT871505	hsa-miR-4436a	CLIP-seq
MIRT1958693	hsa-miR-4436b-3p	CLIP-seq
MIRT871506	hsa-miR-4438	CLIP-seq
MIRT871507	hsa-miR-4439	CLIP-seq
MIRT1958694	hsa-miR-4445	CLIP-seq
MIRT871509	hsa-miR-4461	CLIP-seq
MIRT871510	hsa-miR-4469	CLIP-seq
MIRT871511	hsa-miR-4476	CLIP-seq
MIRT871512	hsa-miR-4478	CLIP-seq
MIRT871513	hsa-miR-4481	CLIP-seq
MIRT871514	hsa-miR-4487	CLIP-seq
MIRT871516	hsa-miR-4494	CLIP-seq
MIRT871517	hsa-miR-449b	CLIP-seq
MIRT871518	hsa-miR-4505	CLIP-seq
MIRT871519	hsa-miR-4507	CLIP-seq
MIRT871522	hsa-miR-4514	CLIP-seq
MIRT871523	hsa-miR-4515	CLIP-seq
MIRT871524	hsa-miR-4517	CLIP-seq
MIRT871525	hsa-miR-4518	CLIP-seq
MIRT871526	hsa-miR-4522	CLIP-seq
MIRT871527	hsa-miR-4524	CLIP-seq
MIRT871528	hsa-miR-4529-3p	CLIP-seq
MIRT871529	hsa-miR-4632	CLIP-seq
MIRT871530	hsa-miR-4648	CLIP-seq
MIRT871532	hsa-miR-4650-3p	CLIP-seq
MIRT871533	hsa-miR-4652-5p	CLIP-seq
MIRT871537	hsa-miR-4659a-3p	CLIP-seq
MIRT871538	hsa-miR-4659b-3p	CLIP-seq
MIRT871540	hsa-miR-4662a-5p	CLIP-seq
MIRT871542	hsa-miR-4666-3p	CLIP-seq
MIRT871543	hsa-miR-4666-5p	CLIP-seq
MIRT871544	hsa-miR-4667-3p	CLIP-seq
MIRT871545	hsa-miR-4667-5p	CLIP-seq
MIRT871549	hsa-miR-4678	CLIP-seq
MIRT871552	hsa-miR-4685-3p	CLIP-seq
MIRT1958695	hsa-miR-4685-5p	CLIP-seq
MIRT871553	hsa-miR-4688	CLIP-seq
MIRT871554	hsa-miR-4690-5p	CLIP-seq
MIRT871555	hsa-miR-4692	CLIP-seq
MIRT871556	hsa-miR-4693-3p	CLIP-seq
MIRT871557	hsa-miR-4698	CLIP-seq
MIRT871558	hsa-miR-4700-3p	CLIP-seq
MIRT871559	hsa-miR-4700-5p	CLIP-seq
MIRT871560	hsa-miR-4704-5p	CLIP-seq
MIRT871561	hsa-miR-4707-3p	CLIP-seq
MIRT871562	hsa-miR-4707-5p	CLIP-seq
MIRT871563	hsa-miR-4712-3p	CLIP-seq
MIRT871565	hsa-miR-4715-3p	CLIP-seq
MIRT1958696	hsa-miR-4722-3p	CLIP-seq
MIRT871566	hsa-miR-4723-3p	CLIP-seq
MIRT871567	hsa-miR-4725-5p	CLIP-seq
MIRT871568	hsa-miR-4729	CLIP-seq
MIRT871569	hsa-miR-4735-5p	CLIP-seq
MIRT871570	hsa-miR-4740-3p	CLIP-seq
MIRT871571	hsa-miR-4740-5p	CLIP-seq
MIRT871572	hsa-miR-4742-3p	CLIP-seq
MIRT871573	hsa-miR-4745-5p	CLIP-seq
MIRT871574	hsa-miR-4753-3p	CLIP-seq
MIRT1958697	hsa-miR-4755-3p	CLIP-seq
MIRT871576	hsa-miR-4757-5p	CLIP-seq
MIRT871577	hsa-miR-4760-3p	CLIP-seq
MIRT871578	hsa-miR-4763-3p	CLIP-seq
MIRT871579	hsa-miR-4766-5p	CLIP-seq
MIRT871580	hsa-miR-4768-5p	CLIP-seq
MIRT871582	hsa-miR-4772-3p	CLIP-seq
MIRT871584	hsa-miR-4775	CLIP-seq
MIRT871585	hsa-miR-4777-5p	CLIP-seq
MIRT871586	hsa-miR-4778-3p	CLIP-seq
MIRT871587	hsa-miR-4783-3p	CLIP-seq
MIRT871588	hsa-miR-4790-3p	CLIP-seq
MIRT871589	hsa-miR-4791	CLIP-seq
MIRT871590	hsa-miR-4793-5p	CLIP-seq
MIRT871591	hsa-miR-4795-5p	CLIP-seq
MIRT871592	hsa-miR-4796-5p	CLIP-seq
MIRT871593	hsa-miR-4802-3p	CLIP-seq
MIRT871594	hsa-miR-487a	CLIP-seq
MIRT871595	hsa-miR-487b	CLIP-seq
MIRT871596	hsa-miR-490-5p	CLIP-seq
MIRT871597	hsa-miR-494	CLIP-seq
MIRT871598	hsa-miR-495	CLIP-seq
MIRT871599	hsa-miR-497	CLIP-seq
MIRT871600	hsa-miR-499a-5p	CLIP-seq
MIRT871601	hsa-miR-500a	CLIP-seq
MIRT871602	hsa-miR-503	CLIP-seq
MIRT871603	hsa-miR-504	CLIP-seq
MIRT871604	hsa-miR-511	CLIP-seq
MIRT871605	hsa-miR-516b	CLIP-seq
MIRT871606	hsa-miR-518a-5p	CLIP-seq
MIRT871607	hsa-miR-518d-5p	CLIP-seq
MIRT871608	hsa-miR-519b-5p	CLIP-seq
MIRT871609	hsa-miR-519c-5p	CLIP-seq
MIRT871610	hsa-miR-519d	CLIP-seq
MIRT871611	hsa-miR-520a-5p	CLIP-seq
MIRT871612	hsa-miR-520c-3p	CLIP-seq
MIRT871613	hsa-miR-520c-5p	CLIP-seq
MIRT871614	hsa-miR-520e	CLIP-seq
MIRT871615	hsa-miR-520f	CLIP-seq
MIRT871616	hsa-miR-520g	CLIP-seq
MIRT871617	hsa-miR-520h	CLIP-seq
MIRT871618	hsa-miR-522	CLIP-seq
MIRT871619	hsa-miR-525-5p	CLIP-seq
MIRT871620	hsa-miR-526a	CLIP-seq
MIRT871621	hsa-miR-526b	CLIP-seq
MIRT871622	hsa-miR-527	CLIP-seq
MIRT1958698	hsa-miR-541	CLIP-seq
MIRT871623	hsa-miR-545	CLIP-seq
MIRT871624	hsa-miR-548a-3p	CLIP-seq
MIRT871625	hsa-miR-548aa	CLIP-seq
MIRT871626	hsa-miR-548ac	CLIP-seq
MIRT871627	hsa-miR-548ad	CLIP-seq
MIRT871628	hsa-miR-548ae	CLIP-seq
MIRT871629	hsa-miR-548ah	CLIP-seq
MIRT871630	hsa-miR-548aj	CLIP-seq
MIRT871631	hsa-miR-548am	CLIP-seq
MIRT871632	hsa-miR-548c-3p	CLIP-seq
MIRT871633	hsa-miR-548d-3p	CLIP-seq
MIRT871634	hsa-miR-548e	CLIP-seq
MIRT871635	hsa-miR-548f	CLIP-seq
MIRT871637	hsa-miR-548o	CLIP-seq
MIRT871638	hsa-miR-548q	CLIP-seq
MIRT871639	hsa-miR-548u	CLIP-seq
MIRT871640	hsa-miR-548x	CLIP-seq
MIRT871641	hsa-miR-548z	CLIP-seq
MIRT871642	hsa-miR-550a	CLIP-seq
MIRT871643	hsa-miR-552	CLIP-seq
MIRT871644	hsa-miR-555	CLIP-seq
MIRT871645	hsa-miR-562	CLIP-seq
MIRT871646	hsa-miR-564	CLIP-seq
MIRT871647	hsa-miR-569	CLIP-seq
MIRT871648	hsa-miR-573	CLIP-seq
MIRT871649	hsa-miR-580	CLIP-seq
MIRT871650	hsa-miR-584	CLIP-seq
MIRT871651	hsa-miR-587	CLIP-seq
MIRT871652	hsa-miR-590-3p	CLIP-seq
MIRT871653	hsa-miR-593	CLIP-seq
MIRT871654	hsa-miR-599	CLIP-seq
MIRT871655	hsa-miR-600	CLIP-seq
MIRT871656	hsa-miR-602	CLIP-seq
MIRT871657	hsa-miR-604	CLIP-seq
MIRT871658	hsa-miR-606	CLIP-seq
MIRT871660	hsa-miR-613	CLIP-seq
MIRT1958699	hsa-miR-615-3p	CLIP-seq
MIRT871661	hsa-miR-617	CLIP-seq
MIRT871662	hsa-miR-619	CLIP-seq
MIRT871664	hsa-miR-625	CLIP-seq
MIRT871666	hsa-miR-632	CLIP-seq
MIRT871667	hsa-miR-634	CLIP-seq
MIRT871668	hsa-miR-636	CLIP-seq
MIRT871669	hsa-miR-637	CLIP-seq
MIRT871671	hsa-miR-641	CLIP-seq
MIRT871672	hsa-miR-644	CLIP-seq
MIRT871673	hsa-miR-647	CLIP-seq
MIRT1958700	hsa-miR-654-5p	CLIP-seq
MIRT871674	hsa-miR-655	CLIP-seq
MIRT871675	hsa-miR-656	CLIP-seq
MIRT1958701	hsa-miR-659	CLIP-seq
MIRT871676	hsa-miR-661	CLIP-seq
MIRT871677	hsa-miR-663	CLIP-seq
MIRT871678	hsa-miR-663b	CLIP-seq
MIRT871679	hsa-miR-668	CLIP-seq
MIRT871681	hsa-miR-873	CLIP-seq
MIRT871682	hsa-miR-885-5p	CLIP-seq
MIRT871683	hsa-miR-889	CLIP-seq
MIRT871684	hsa-miR-93	CLIP-seq
MIRT871686	hsa-miR-942	CLIP-seq
MIRT871687	hsa-miR-943	CLIP-seq
MIRT871688	hsa-miR-95	CLIP-seq
MIRT871689	hsa-miR-96	CLIP-seq
MIRT871690	hsa-miR-98	CLIP-seq
MIRT871302	hsa-let-7a	CLIP-seq
MIRT871303	hsa-let-7b	CLIP-seq
MIRT871304	hsa-let-7c	CLIP-seq
MIRT871305	hsa-let-7d	CLIP-seq
MIRT871306	hsa-let-7e	CLIP-seq
MIRT871307	hsa-let-7f	CLIP-seq
MIRT871308	hsa-let-7g	CLIP-seq
MIRT871309	hsa-let-7i	CLIP-seq
MIRT871311	hsa-miR-103b	CLIP-seq
MIRT871312	hsa-miR-106a	CLIP-seq
MIRT871313	hsa-miR-106b	CLIP-seq
MIRT871314	hsa-miR-1179	CLIP-seq
MIRT871315	hsa-miR-1183	CLIP-seq
MIRT2195428	hsa-miR-1203	CLIP-seq
MIRT871317	hsa-miR-1207-5p	CLIP-seq
MIRT1958687	hsa-miR-1224-3p	CLIP-seq
MIRT871318	hsa-miR-1225-5p	CLIP-seq
MIRT1958688	hsa-miR-1226	CLIP-seq
MIRT871319	hsa-miR-1228	CLIP-seq
MIRT871320	hsa-miR-1229	CLIP-seq
MIRT871321	hsa-miR-1234	CLIP-seq
MIRT871322	hsa-miR-1237	CLIP-seq
MIRT871323	hsa-miR-1245b-3p	CLIP-seq
MIRT871325	hsa-miR-1254	CLIP-seq
MIRT871326	hsa-miR-1266	CLIP-seq
MIRT871327	hsa-miR-1269	CLIP-seq
MIRT871328	hsa-miR-1269b	CLIP-seq
MIRT871329	hsa-miR-1271	CLIP-seq
MIRT871330	hsa-miR-1272	CLIP-seq
MIRT871331	hsa-miR-1273g	CLIP-seq
MIRT871332	hsa-miR-127-5p	CLIP-seq
MIRT871333	hsa-miR-128	CLIP-seq
MIRT871334	hsa-miR-1280	CLIP-seq
MIRT871335	hsa-miR-1281	CLIP-seq
MIRT871336	hsa-miR-1283	CLIP-seq
MIRT871337	hsa-miR-1287	CLIP-seq
MIRT871338	hsa-miR-1288	CLIP-seq
MIRT871339	hsa-miR-1289	CLIP-seq
MIRT871340	hsa-miR-1302	CLIP-seq
MIRT871341	hsa-miR-1322	CLIP-seq
MIRT871342	hsa-miR-1323	CLIP-seq
MIRT871343	hsa-miR-1324	CLIP-seq
MIRT871345	hsa-miR-139-3p	CLIP-seq
MIRT871346	hsa-miR-140-3p	CLIP-seq
MIRT871347	hsa-miR-147	CLIP-seq
MIRT871348	hsa-miR-1471	CLIP-seq
MIRT871349	hsa-miR-150	CLIP-seq
MIRT871350	hsa-miR-1537	CLIP-seq
MIRT871351	hsa-miR-155	CLIP-seq
MIRT871352	hsa-miR-15a	CLIP-seq
MIRT871353	hsa-miR-15b	CLIP-seq
MIRT871354	hsa-miR-16	CLIP-seq
MIRT871355	hsa-miR-17	CLIP-seq
MIRT871356	hsa-miR-186	CLIP-seq
MIRT871357	hsa-miR-187	CLIP-seq
MIRT871358	hsa-miR-18a	CLIP-seq
MIRT871359	hsa-miR-18b	CLIP-seq
MIRT871360	hsa-miR-1908	CLIP-seq
MIRT871361	hsa-miR-1909	CLIP-seq
MIRT871362	hsa-miR-1911	CLIP-seq
MIRT871363	hsa-miR-1913	CLIP-seq
MIRT871364	hsa-miR-193b	CLIP-seq
MIRT871366	hsa-miR-195	CLIP-seq
MIRT1958690	hsa-miR-1973	CLIP-seq
MIRT871367	hsa-miR-19a	CLIP-seq
MIRT871368	hsa-miR-19b	CLIP-seq
MIRT871369	hsa-miR-202	CLIP-seq
MIRT871370	hsa-miR-204	CLIP-seq
MIRT871371	hsa-miR-2053	CLIP-seq
MIRT871372	hsa-miR-2054	CLIP-seq
MIRT871373	hsa-miR-20a	CLIP-seq
MIRT871374	hsa-miR-20b	CLIP-seq
MIRT871375	hsa-miR-211	CLIP-seq
MIRT871377	hsa-miR-218	CLIP-seq
MIRT871378	hsa-miR-219-1-3p	CLIP-seq
MIRT871379	hsa-miR-224	CLIP-seq
MIRT871380	hsa-miR-2276	CLIP-seq
MIRT871381	hsa-miR-2278	CLIP-seq
MIRT871382	hsa-miR-23a	CLIP-seq
MIRT871383	hsa-miR-23b	CLIP-seq
MIRT871384	hsa-miR-23c	CLIP-seq
MIRT871385	hsa-miR-302a	CLIP-seq
MIRT871386	hsa-miR-302b	CLIP-seq
MIRT871387	hsa-miR-302c	CLIP-seq
MIRT871388	hsa-miR-302d	CLIP-seq
MIRT871389	hsa-miR-302e	CLIP-seq
MIRT871390	hsa-miR-3064-3p	CLIP-seq
MIRT871392	hsa-miR-3065-5p	CLIP-seq
MIRT871393	hsa-miR-3116	CLIP-seq
MIRT871394	hsa-miR-3120-3p	CLIP-seq
MIRT871395	hsa-miR-3121-3p	CLIP-seq
MIRT871396	hsa-miR-3121-5p	CLIP-seq
MIRT871398	hsa-miR-3128	CLIP-seq
MIRT871399	hsa-miR-3132	CLIP-seq
MIRT871400	hsa-miR-3135	CLIP-seq
MIRT871401	hsa-miR-3135b	CLIP-seq
MIRT871402	hsa-miR-3136-3p	CLIP-seq
MIRT871403	hsa-miR-3136-5p	CLIP-seq
MIRT871404	hsa-miR-3137	CLIP-seq
MIRT871406	hsa-miR-3144-5p	CLIP-seq
MIRT871407	hsa-miR-3151	CLIP-seq
MIRT871408	hsa-miR-3152-3p	CLIP-seq
MIRT871409	hsa-miR-3152-5p	CLIP-seq
MIRT871410	hsa-miR-3160-3p	CLIP-seq
MIRT871411	hsa-miR-3162-3p	CLIP-seq
MIRT871412	hsa-miR-3163	CLIP-seq
MIRT871413	hsa-miR-3164	CLIP-seq
MIRT871414	hsa-miR-3175	CLIP-seq
MIRT871415	hsa-miR-3176	CLIP-seq
MIRT871416	hsa-miR-3180	CLIP-seq
MIRT871417	hsa-miR-3180-3p	CLIP-seq
MIRT871418	hsa-miR-3180-5p	CLIP-seq
MIRT871419	hsa-miR-3182	CLIP-seq
MIRT871420	hsa-miR-3183	CLIP-seq
MIRT871421	hsa-miR-3185	CLIP-seq
MIRT871422	hsa-miR-3186-3p	CLIP-seq
MIRT871423	hsa-miR-3191	CLIP-seq
MIRT871425	hsa-miR-3196	CLIP-seq
MIRT871426	hsa-miR-3198	CLIP-seq
MIRT2195429	hsa-miR-3199	CLIP-seq
MIRT871428	hsa-miR-323-3p	CLIP-seq
MIRT871429	hsa-miR-323-5p	CLIP-seq
MIRT871430	hsa-miR-324-3p	CLIP-seq
MIRT871431	hsa-miR-329	CLIP-seq
MIRT871432	hsa-miR-330-3p	CLIP-seq
MIRT871433	hsa-miR-33a	CLIP-seq
MIRT871434	hsa-miR-33b	CLIP-seq
MIRT871435	hsa-miR-340	CLIP-seq
MIRT871436	hsa-miR-342-3p	CLIP-seq
MIRT871437	hsa-miR-346	CLIP-seq
MIRT871438	hsa-miR-34a	CLIP-seq
MIRT871439	hsa-miR-34b	CLIP-seq
MIRT871440	hsa-miR-3607-3p	CLIP-seq
MIRT871441	hsa-miR-3611	CLIP-seq
MIRT871442	hsa-miR-3613-3p	CLIP-seq
MIRT871443	hsa-miR-361-3p	CLIP-seq
MIRT871445	hsa-miR-361-5p	CLIP-seq
MIRT871446	hsa-miR-3616-5p	CLIP-seq
MIRT871447	hsa-miR-3617	CLIP-seq
MIRT871448	hsa-miR-362-3p	CLIP-seq
MIRT871449	hsa-miR-3647-5p	CLIP-seq
MIRT871450	hsa-miR-365	CLIP-seq
MIRT2195430	hsa-miR-3663-3p	CLIP-seq
MIRT871453	hsa-miR-3669	CLIP-seq
MIRT871454	hsa-miR-3673	CLIP-seq
MIRT871455	hsa-miR-3677-5p	CLIP-seq
MIRT871456	hsa-miR-3685	CLIP-seq
MIRT871457	hsa-miR-3686	CLIP-seq
MIRT871458	hsa-miR-3690	CLIP-seq
MIRT871459	hsa-miR-370	CLIP-seq
MIRT871460	hsa-miR-371b-3p	CLIP-seq
MIRT871461	hsa-miR-372	CLIP-seq
MIRT871462	hsa-miR-373	CLIP-seq
MIRT871463	hsa-miR-374a	CLIP-seq
MIRT871464	hsa-miR-374b	CLIP-seq
MIRT871465	hsa-miR-374c	CLIP-seq
MIRT871466	hsa-miR-376c	CLIP-seq
MIRT871467	hsa-miR-383	CLIP-seq
MIRT871468	hsa-miR-384	CLIP-seq
MIRT871469	hsa-miR-3909	CLIP-seq
MIRT871471	hsa-miR-3911	CLIP-seq
MIRT871472	hsa-miR-3918	CLIP-seq
MIRT871473	hsa-miR-3921	CLIP-seq
MIRT871474	hsa-miR-3922-3p	CLIP-seq
MIRT871475	hsa-miR-3923	CLIP-seq
MIRT871476	hsa-miR-3929	CLIP-seq
MIRT871478	hsa-miR-3978	CLIP-seq
MIRT871479	hsa-miR-421	CLIP-seq
MIRT871480	hsa-miR-424	CLIP-seq
MIRT871481	hsa-miR-425	CLIP-seq
MIRT871482	hsa-miR-4258	CLIP-seq
MIRT871483	hsa-miR-4263	CLIP-seq
MIRT871484	hsa-miR-4265	CLIP-seq
MIRT871486	hsa-miR-4286	CLIP-seq
MIRT871487	hsa-miR-4287	CLIP-seq
MIRT871488	hsa-miR-4288	CLIP-seq
MIRT871489	hsa-miR-4290	CLIP-seq
MIRT871490	hsa-miR-4294	CLIP-seq
MIRT871491	hsa-miR-4296	CLIP-seq
MIRT871492	hsa-miR-4298	CLIP-seq
MIRT871493	hsa-miR-4301	CLIP-seq
MIRT871494	hsa-miR-4305	CLIP-seq
MIRT871496	hsa-miR-4309	CLIP-seq
MIRT871498	hsa-miR-4322	CLIP-seq
MIRT1958692	hsa-miR-4325	CLIP-seq
MIRT871499	hsa-miR-4327	CLIP-seq
MIRT871500	hsa-miR-4328	CLIP-seq
MIRT871501	hsa-miR-4417	CLIP-seq
MIRT871502	hsa-miR-4419b	CLIP-seq
MIRT871503	hsa-miR-4428	CLIP-seq
MIRT1958693	hsa-miR-4436b-3p	CLIP-seq
MIRT871506	hsa-miR-4438	CLIP-seq
MIRT871507	hsa-miR-4439	CLIP-seq
MIRT871508	hsa-miR-4446-5p	CLIP-seq
MIRT871509	hsa-miR-4461	CLIP-seq
MIRT871510	hsa-miR-4469	CLIP-seq
MIRT871511	hsa-miR-4476	CLIP-seq
MIRT871512	hsa-miR-4478	CLIP-seq
MIRT871513	hsa-miR-4481	CLIP-seq
MIRT871514	hsa-miR-4487	CLIP-seq
MIRT871515	hsa-miR-4490	CLIP-seq
MIRT871517	hsa-miR-449b	CLIP-seq
MIRT871519	hsa-miR-4507	CLIP-seq
MIRT871522	hsa-miR-4514	CLIP-seq
MIRT871523	hsa-miR-4515	CLIP-seq
MIRT871525	hsa-miR-4518	CLIP-seq
MIRT871527	hsa-miR-4524	CLIP-seq
MIRT871528	hsa-miR-4529-3p	CLIP-seq
MIRT871530	hsa-miR-4648	CLIP-seq
MIRT871531	hsa-miR-4649-3p	CLIP-seq
MIRT871532	hsa-miR-4650-3p	CLIP-seq
MIRT871533	hsa-miR-4652-5p	CLIP-seq
MIRT871534	hsa-miR-4653-5p	CLIP-seq
MIRT871536	hsa-miR-4655-5p	CLIP-seq
MIRT871537	hsa-miR-4659a-3p	CLIP-seq
MIRT871538	hsa-miR-4659b-3p	CLIP-seq
MIRT871540	hsa-miR-4662a-5p	CLIP-seq
MIRT871542	hsa-miR-4666-3p	CLIP-seq
MIRT871543	hsa-miR-4666-5p	CLIP-seq
MIRT871544	hsa-miR-4667-3p	CLIP-seq
MIRT871545	hsa-miR-4667-5p	CLIP-seq
MIRT871548	hsa-miR-4677-3p	CLIP-seq
MIRT871549	hsa-miR-4678	CLIP-seq
MIRT871552	hsa-miR-4685-3p	CLIP-seq
MIRT1958695	hsa-miR-4685-5p	CLIP-seq
MIRT871553	hsa-miR-4688	CLIP-seq
MIRT871554	hsa-miR-4690-5p	CLIP-seq
MIRT871555	hsa-miR-4692	CLIP-seq
MIRT871556	hsa-miR-4693-3p	CLIP-seq
MIRT871557	hsa-miR-4698	CLIP-seq
MIRT871559	hsa-miR-4700-5p	CLIP-seq
MIRT871560	hsa-miR-4704-5p	CLIP-seq
MIRT871561	hsa-miR-4707-3p	CLIP-seq
MIRT871562	hsa-miR-4707-5p	CLIP-seq
MIRT871563	hsa-miR-4712-3p	CLIP-seq
MIRT871565	hsa-miR-4715-3p	CLIP-seq
MIRT1958696	hsa-miR-4722-3p	CLIP-seq
MIRT871566	hsa-miR-4723-3p	CLIP-seq
MIRT871567	hsa-miR-4725-5p	CLIP-seq
MIRT871568	hsa-miR-4729	CLIP-seq
MIRT871569	hsa-miR-4735-5p	CLIP-seq
MIRT871570	hsa-miR-4740-3p	CLIP-seq
MIRT871571	hsa-miR-4740-5p	CLIP-seq
MIRT871573	hsa-miR-4745-5p	CLIP-seq
MIRT871574	hsa-miR-4753-3p	CLIP-seq
MIRT1958697	hsa-miR-4755-3p	CLIP-seq
MIRT871575	hsa-miR-4755-5p	CLIP-seq
MIRT871576	hsa-miR-4757-5p	CLIP-seq
MIRT871577	hsa-miR-4760-3p	CLIP-seq
MIRT871578	hsa-miR-4763-3p	CLIP-seq
MIRT871579	hsa-miR-4766-5p	CLIP-seq
MIRT871582	hsa-miR-4772-3p	CLIP-seq
MIRT871583	hsa-miR-4774-5p	CLIP-seq
MIRT871584	hsa-miR-4775	CLIP-seq
MIRT871585	hsa-miR-4777-5p	CLIP-seq
MIRT871586	hsa-miR-4778-3p	CLIP-seq
MIRT2195431	hsa-miR-4779	CLIP-seq
MIRT2195432	hsa-miR-4781-5p	CLIP-seq
MIRT871587	hsa-miR-4783-3p	CLIP-seq
MIRT871590	hsa-miR-4793-5p	CLIP-seq
MIRT871591	hsa-miR-4795-5p	CLIP-seq
MIRT871592	hsa-miR-4796-5p	CLIP-seq
MIRT871593	hsa-miR-4802-3p	CLIP-seq
MIRT871594	hsa-miR-487a	CLIP-seq
MIRT871595	hsa-miR-487b	CLIP-seq
MIRT871596	hsa-miR-490-5p	CLIP-seq
MIRT871597	hsa-miR-494	CLIP-seq
MIRT871598	hsa-miR-495	CLIP-seq
MIRT871599	hsa-miR-497	CLIP-seq
MIRT871601	hsa-miR-500a	CLIP-seq
MIRT871602	hsa-miR-503	CLIP-seq
MIRT871603	hsa-miR-504	CLIP-seq
MIRT871604	hsa-miR-511	CLIP-seq
MIRT871605	hsa-miR-516b	CLIP-seq
MIRT871606	hsa-miR-518a-5p	CLIP-seq
MIRT871607	hsa-miR-518d-5p	CLIP-seq
MIRT871608	hsa-miR-519b-5p	CLIP-seq
MIRT871609	hsa-miR-519c-5p	CLIP-seq
MIRT871610	hsa-miR-519d	CLIP-seq
MIRT871611	hsa-miR-520a-5p	CLIP-seq
MIRT871612	hsa-miR-520c-3p	CLIP-seq
MIRT871613	hsa-miR-520c-5p	CLIP-seq
MIRT871614	hsa-miR-520e	CLIP-seq
MIRT871615	hsa-miR-520f	CLIP-seq
MIRT871616	hsa-miR-520g	CLIP-seq
MIRT871617	hsa-miR-520h	CLIP-seq
MIRT871619	hsa-miR-525-5p	CLIP-seq
MIRT871620	hsa-miR-526a	CLIP-seq
MIRT871621	hsa-miR-526b	CLIP-seq
MIRT871622	hsa-miR-527	CLIP-seq
MIRT871623	hsa-miR-545	CLIP-seq
MIRT871624	hsa-miR-548a-3p	CLIP-seq
MIRT871625	hsa-miR-548aa	CLIP-seq
MIRT871626	hsa-miR-548ac	CLIP-seq
MIRT871627	hsa-miR-548ad	CLIP-seq
MIRT871628	hsa-miR-548ae	CLIP-seq
MIRT871629	hsa-miR-548ah	CLIP-seq
MIRT871630	hsa-miR-548aj	CLIP-seq
MIRT871631	hsa-miR-548am	CLIP-seq
MIRT871632	hsa-miR-548c-3p	CLIP-seq
MIRT871633	hsa-miR-548d-3p	CLIP-seq
MIRT871634	hsa-miR-548e	CLIP-seq
MIRT871635	hsa-miR-548f	CLIP-seq
MIRT871637	hsa-miR-548o	CLIP-seq
MIRT871640	hsa-miR-548x	CLIP-seq
MIRT871641	hsa-miR-548z	CLIP-seq
MIRT871642	hsa-miR-550a	CLIP-seq
MIRT871643	hsa-miR-552	CLIP-seq
MIRT871645	hsa-miR-562	CLIP-seq
MIRT871646	hsa-miR-564	CLIP-seq
MIRT871647	hsa-miR-569	CLIP-seq
MIRT871648	hsa-miR-573	CLIP-seq
MIRT871649	hsa-miR-580	CLIP-seq
MIRT871650	hsa-miR-584	CLIP-seq
MIRT871651	hsa-miR-587	CLIP-seq
MIRT871652	hsa-miR-590-3p	CLIP-seq
MIRT871653	hsa-miR-593	CLIP-seq
MIRT871654	hsa-miR-599	CLIP-seq
MIRT871655	hsa-miR-600	CLIP-seq
MIRT871656	hsa-miR-602	CLIP-seq
MIRT871658	hsa-miR-606	CLIP-seq
MIRT871659	hsa-miR-607	CLIP-seq
MIRT871661	hsa-miR-617	CLIP-seq
MIRT871662	hsa-miR-619	CLIP-seq
MIRT871663	hsa-miR-623	CLIP-seq
MIRT871664	hsa-miR-625	CLIP-seq
MIRT871666	hsa-miR-632	CLIP-seq
MIRT871667	hsa-miR-634	CLIP-seq
MIRT871668	hsa-miR-636	CLIP-seq
MIRT871669	hsa-miR-637	CLIP-seq
MIRT871671	hsa-miR-641	CLIP-seq
MIRT871672	hsa-miR-644	CLIP-seq
MIRT871674	hsa-miR-655	CLIP-seq
MIRT871675	hsa-miR-656	CLIP-seq
MIRT1958701	hsa-miR-659	CLIP-seq
MIRT871676	hsa-miR-661	CLIP-seq
MIRT871677	hsa-miR-663	CLIP-seq
MIRT871678	hsa-miR-663b	CLIP-seq
MIRT2195433	hsa-miR-665	CLIP-seq
MIRT871679	hsa-miR-668	CLIP-seq
MIRT871681	hsa-miR-873	CLIP-seq
MIRT871683	hsa-miR-889	CLIP-seq
MIRT871684	hsa-miR-93	CLIP-seq
MIRT871685	hsa-miR-938	CLIP-seq
MIRT2195434	hsa-miR-939	CLIP-seq
MIRT871686	hsa-miR-942	CLIP-seq
MIRT871687	hsa-miR-943	CLIP-seq
MIRT871688	hsa-miR-95	CLIP-seq
MIRT871689	hsa-miR-96	CLIP-seq
MIRT871690	hsa-miR-98	CLIP-seq
MIRT871302	hsa-let-7a	CLIP-seq
MIRT871303	hsa-let-7b	CLIP-seq
MIRT871304	hsa-let-7c	CLIP-seq
MIRT871305	hsa-let-7d	CLIP-seq
MIRT871306	hsa-let-7e	CLIP-seq
MIRT871307	hsa-let-7f	CLIP-seq
MIRT871308	hsa-let-7g	CLIP-seq
MIRT871309	hsa-let-7i	CLIP-seq
MIRT871312	hsa-miR-106a	CLIP-seq
MIRT871313	hsa-miR-106b	CLIP-seq
MIRT871314	hsa-miR-1179	CLIP-seq
MIRT871317	hsa-miR-1207-5p	CLIP-seq
MIRT1958687	hsa-miR-1224-3p	CLIP-seq
MIRT1958688	hsa-miR-1226	CLIP-seq
MIRT871319	hsa-miR-1228	CLIP-seq
MIRT871320	hsa-miR-1229	CLIP-seq
MIRT871321	hsa-miR-1234	CLIP-seq
MIRT871325	hsa-miR-1254	CLIP-seq
MIRT871335	hsa-miR-1281	CLIP-seq
MIRT871337	hsa-miR-1287	CLIP-seq
MIRT871339	hsa-miR-1289	CLIP-seq
MIRT871343	hsa-miR-1324	CLIP-seq
MIRT871345	hsa-miR-139-3p	CLIP-seq
MIRT871346	hsa-miR-140-3p	CLIP-seq
MIRT871347	hsa-miR-147	CLIP-seq
MIRT871349	hsa-miR-150	CLIP-seq
MIRT871350	hsa-miR-1537	CLIP-seq
MIRT871351	hsa-miR-155	CLIP-seq
MIRT871352	hsa-miR-15a	CLIP-seq
MIRT871353	hsa-miR-15b	CLIP-seq
MIRT871354	hsa-miR-16	CLIP-seq
MIRT871355	hsa-miR-17	CLIP-seq
MIRT871358	hsa-miR-18a	CLIP-seq
MIRT871359	hsa-miR-18b	CLIP-seq
MIRT871361	hsa-miR-1909	CLIP-seq
MIRT871366	hsa-miR-195	CLIP-seq
MIRT871367	hsa-miR-19a	CLIP-seq
MIRT871368	hsa-miR-19b	CLIP-seq
MIRT871369	hsa-miR-202	CLIP-seq
MIRT871371	hsa-miR-2053	CLIP-seq
MIRT871373	hsa-miR-20a	CLIP-seq
MIRT871374	hsa-miR-20b	CLIP-seq
MIRT871379	hsa-miR-224	CLIP-seq
MIRT871381	hsa-miR-2278	CLIP-seq
MIRT871382	hsa-miR-23a	CLIP-seq
MIRT871383	hsa-miR-23b	CLIP-seq
MIRT871384	hsa-miR-23c	CLIP-seq
MIRT871390	hsa-miR-3064-3p	CLIP-seq
MIRT871393	hsa-miR-3116	CLIP-seq
MIRT871396	hsa-miR-3121-5p	CLIP-seq
MIRT871401	hsa-miR-3135b	CLIP-seq
MIRT871406	hsa-miR-3144-5p	CLIP-seq
MIRT871408	hsa-miR-3152-3p	CLIP-seq
MIRT871409	hsa-miR-3152-5p	CLIP-seq
MIRT871410	hsa-miR-3160-3p	CLIP-seq
MIRT871412	hsa-miR-3163	CLIP-seq
MIRT871413	hsa-miR-3164	CLIP-seq
MIRT871418	hsa-miR-3180-5p	CLIP-seq
MIRT871419	hsa-miR-3182	CLIP-seq
MIRT871420	hsa-miR-3183	CLIP-seq
MIRT871423	hsa-miR-3191	CLIP-seq
MIRT871426	hsa-miR-3198	CLIP-seq
MIRT871429	hsa-miR-323-5p	CLIP-seq
MIRT871435	hsa-miR-340	CLIP-seq
MIRT871436	hsa-miR-342-3p	CLIP-seq
MIRT871439	hsa-miR-34b	CLIP-seq
MIRT871447	hsa-miR-3617	CLIP-seq
MIRT871450	hsa-miR-365	CLIP-seq
MIRT871453	hsa-miR-3669	CLIP-seq
MIRT871459	hsa-miR-370	CLIP-seq
MIRT871463	hsa-miR-374a	CLIP-seq
MIRT871464	hsa-miR-374b	CLIP-seq
MIRT871469	hsa-miR-3909	CLIP-seq
MIRT871479	hsa-miR-421	CLIP-seq
MIRT871480	hsa-miR-424	CLIP-seq
MIRT871482	hsa-miR-4258	CLIP-seq
MIRT871484	hsa-miR-4265	CLIP-seq
MIRT871487	hsa-miR-4287	CLIP-seq
MIRT871490	hsa-miR-4294	CLIP-seq
MIRT871491	hsa-miR-4296	CLIP-seq
MIRT871494	hsa-miR-4305	CLIP-seq
MIRT871496	hsa-miR-4309	CLIP-seq
MIRT871498	hsa-miR-4322	CLIP-seq
MIRT871499	hsa-miR-4327	CLIP-seq
MIRT871500	hsa-miR-4328	CLIP-seq
MIRT871501	hsa-miR-4417	CLIP-seq
MIRT871509	hsa-miR-4461	CLIP-seq
MIRT871510	hsa-miR-4469	CLIP-seq
MIRT871511	hsa-miR-4476	CLIP-seq
MIRT871514	hsa-miR-4487	CLIP-seq
MIRT871527	hsa-miR-4524	CLIP-seq
MIRT871533	hsa-miR-4652-5p	CLIP-seq
MIRT871536	hsa-miR-4655-5p	CLIP-seq
MIRT871537	hsa-miR-4659a-3p	CLIP-seq
MIRT871538	hsa-miR-4659b-3p	CLIP-seq
MIRT871542	hsa-miR-4666-3p	CLIP-seq
MIRT871545	hsa-miR-4667-5p	CLIP-seq
MIRT871548	hsa-miR-4677-3p	CLIP-seq
MIRT871552	hsa-miR-4685-3p	CLIP-seq
MIRT871553	hsa-miR-4688	CLIP-seq
MIRT871556	hsa-miR-4693-3p	CLIP-seq
MIRT871559	hsa-miR-4700-5p	CLIP-seq
MIRT871562	hsa-miR-4707-5p	CLIP-seq
MIRT871563	hsa-miR-4712-3p	CLIP-seq
MIRT871565	hsa-miR-4715-3p	CLIP-seq
MIRT871566	hsa-miR-4723-3p	CLIP-seq
MIRT871570	hsa-miR-4740-3p	CLIP-seq
MIRT871574	hsa-miR-4753-3p	CLIP-seq
MIRT871576	hsa-miR-4757-5p	CLIP-seq
MIRT871578	hsa-miR-4763-3p	CLIP-seq
MIRT871585	hsa-miR-4777-5p	CLIP-seq
MIRT871587	hsa-miR-4783-3p	CLIP-seq
MIRT871592	hsa-miR-4796-5p	CLIP-seq
MIRT871593	hsa-miR-4802-3p	CLIP-seq
MIRT871595	hsa-miR-487b	CLIP-seq
MIRT871597	hsa-miR-494	CLIP-seq
MIRT871599	hsa-miR-497	CLIP-seq
MIRT871601	hsa-miR-500a	CLIP-seq
MIRT871602	hsa-miR-503	CLIP-seq
MIRT871604	hsa-miR-511	CLIP-seq
MIRT871606	hsa-miR-518a-5p	CLIP-seq
MIRT871607	hsa-miR-518d-5p	CLIP-seq
MIRT871608	hsa-miR-519b-5p	CLIP-seq
MIRT871609	hsa-miR-519c-5p	CLIP-seq
MIRT871610	hsa-miR-519d	CLIP-seq
MIRT871611	hsa-miR-520a-5p	CLIP-seq
MIRT871613	hsa-miR-520c-5p	CLIP-seq
MIRT871616	hsa-miR-520g	CLIP-seq
MIRT871617	hsa-miR-520h	CLIP-seq
MIRT871619	hsa-miR-525-5p	CLIP-seq
MIRT871620	hsa-miR-526a	CLIP-seq
MIRT871622	hsa-miR-527	CLIP-seq
MIRT871623	hsa-miR-545	CLIP-seq
MIRT871626	hsa-miR-548ac	CLIP-seq
MIRT871628	hsa-miR-548ae	CLIP-seq
MIRT871629	hsa-miR-548ah	CLIP-seq
MIRT871630	hsa-miR-548aj	CLIP-seq
MIRT871631	hsa-miR-548am	CLIP-seq
MIRT871633	hsa-miR-548d-3p	CLIP-seq
MIRT871640	hsa-miR-548x	CLIP-seq
MIRT871641	hsa-miR-548z	CLIP-seq
MIRT871642	hsa-miR-550a	CLIP-seq
MIRT871643	hsa-miR-552	CLIP-seq
MIRT871646	hsa-miR-564	CLIP-seq
MIRT871647	hsa-miR-569	CLIP-seq
MIRT871650	hsa-miR-584	CLIP-seq
MIRT871653	hsa-miR-593	CLIP-seq
MIRT871654	hsa-miR-599	CLIP-seq
MIRT871655	hsa-miR-600	CLIP-seq
MIRT871656	hsa-miR-602	CLIP-seq
MIRT871661	hsa-miR-617	CLIP-seq
MIRT871669	hsa-miR-637	CLIP-seq
MIRT871671	hsa-miR-641	CLIP-seq
MIRT1958701	hsa-miR-659	CLIP-seq
MIRT871676	hsa-miR-661	CLIP-seq
MIRT871679	hsa-miR-668	CLIP-seq
MIRT871684	hsa-miR-93	CLIP-seq
MIRT871686	hsa-miR-942	CLIP-seq
MIRT871688	hsa-miR-95	CLIP-seq
MIRT871690	hsa-miR-98	CLIP-seq
MIRT871314	hsa-miR-1179	CLIP-seq
MIRT871317	hsa-miR-1207-5p	CLIP-seq
MIRT1958687	hsa-miR-1224-3p	CLIP-seq
MIRT871330	hsa-miR-1272	CLIP-seq
MIRT871332	hsa-miR-127-5p	CLIP-seq
MIRT871336	hsa-miR-1283	CLIP-seq
MIRT871341	hsa-miR-1322	CLIP-seq
MIRT871342	hsa-miR-1323	CLIP-seq
MIRT871347	hsa-miR-147	CLIP-seq
MIRT871349	hsa-miR-150	CLIP-seq
MIRT871351	hsa-miR-155	CLIP-seq
MIRT871352	hsa-miR-15a	CLIP-seq
MIRT871353	hsa-miR-15b	CLIP-seq
MIRT871354	hsa-miR-16	CLIP-seq
MIRT871358	hsa-miR-18a	CLIP-seq
MIRT871359	hsa-miR-18b	CLIP-seq
MIRT871361	hsa-miR-1909	CLIP-seq
MIRT871364	hsa-miR-193b	CLIP-seq
MIRT871366	hsa-miR-195	CLIP-seq
MIRT871371	hsa-miR-2053	CLIP-seq
MIRT871372	hsa-miR-2054	CLIP-seq
MIRT871377	hsa-miR-218	CLIP-seq
MIRT871378	hsa-miR-219-1-3p	CLIP-seq
MIRT871379	hsa-miR-224	CLIP-seq
MIRT871380	hsa-miR-2276	CLIP-seq
MIRT871381	hsa-miR-2278	CLIP-seq
MIRT871382	hsa-miR-23a	CLIP-seq
MIRT871383	hsa-miR-23b	CLIP-seq
MIRT871384	hsa-miR-23c	CLIP-seq
MIRT871392	hsa-miR-3065-5p	CLIP-seq
MIRT871394	hsa-miR-3120-3p	CLIP-seq
MIRT871400	hsa-miR-3135	CLIP-seq
MIRT871408	hsa-miR-3152-3p	CLIP-seq
MIRT871412	hsa-miR-3163	CLIP-seq
MIRT871415	hsa-miR-3176	CLIP-seq
MIRT871418	hsa-miR-3180-5p	CLIP-seq
MIRT871424	hsa-miR-3192	CLIP-seq
MIRT871428	hsa-miR-323-3p	CLIP-seq
MIRT871435	hsa-miR-340	CLIP-seq
MIRT871438	hsa-miR-34a	CLIP-seq
MIRT871439	hsa-miR-34b	CLIP-seq
MIRT871440	hsa-miR-3607-3p	CLIP-seq
MIRT871441	hsa-miR-3611	CLIP-seq
MIRT871442	hsa-miR-3613-3p	CLIP-seq
MIRT871444	hsa-miR-3614-3p	CLIP-seq
MIRT871445	hsa-miR-361-5p	CLIP-seq
MIRT871447	hsa-miR-3617	CLIP-seq
MIRT871450	hsa-miR-365	CLIP-seq
MIRT871453	hsa-miR-3669	CLIP-seq
MIRT871454	hsa-miR-3673	CLIP-seq
MIRT871456	hsa-miR-3685	CLIP-seq
MIRT871463	hsa-miR-374a	CLIP-seq
MIRT871464	hsa-miR-374b	CLIP-seq
MIRT871465	hsa-miR-374c	CLIP-seq
MIRT871468	hsa-miR-384	CLIP-seq
MIRT871471	hsa-miR-3911	CLIP-seq
MIRT871472	hsa-miR-3918	CLIP-seq
MIRT871474	hsa-miR-3922-3p	CLIP-seq
MIRT871475	hsa-miR-3923	CLIP-seq
MIRT871476	hsa-miR-3929	CLIP-seq
MIRT871480	hsa-miR-424	CLIP-seq
MIRT871481	hsa-miR-425	CLIP-seq
MIRT871483	hsa-miR-4263	CLIP-seq
MIRT871486	hsa-miR-4286	CLIP-seq
MIRT871489	hsa-miR-4290	CLIP-seq
MIRT871493	hsa-miR-4301	CLIP-seq
MIRT871495	hsa-miR-4307	CLIP-seq
MIRT871497	hsa-miR-4314	CLIP-seq
MIRT871502	hsa-miR-4419b	CLIP-seq
MIRT871503	hsa-miR-4428	CLIP-seq
MIRT1958693	hsa-miR-4436b-3p	CLIP-seq
MIRT871506	hsa-miR-4438	CLIP-seq
MIRT871511	hsa-miR-4476	CLIP-seq
MIRT871512	hsa-miR-4478	CLIP-seq
MIRT871517	hsa-miR-449b	CLIP-seq
MIRT871526	hsa-miR-4522	CLIP-seq
MIRT871527	hsa-miR-4524	CLIP-seq
MIRT871542	hsa-miR-4666-3p	CLIP-seq
MIRT871547	hsa-miR-4668-5p	CLIP-seq
MIRT871550	hsa-miR-4680-3p	CLIP-seq
MIRT1958695	hsa-miR-4685-5p	CLIP-seq
MIRT871553	hsa-miR-4688	CLIP-seq
MIRT871556	hsa-miR-4693-3p	CLIP-seq
MIRT871557	hsa-miR-4698	CLIP-seq
MIRT871560	hsa-miR-4704-5p	CLIP-seq
MIRT871563	hsa-miR-4712-3p	CLIP-seq
MIRT1958696	hsa-miR-4722-3p	CLIP-seq
MIRT871567	hsa-miR-4725-5p	CLIP-seq
MIRT871574	hsa-miR-4753-3p	CLIP-seq
MIRT1958697	hsa-miR-4755-3p	CLIP-seq
MIRT871578	hsa-miR-4763-3p	CLIP-seq
MIRT871582	hsa-miR-4772-3p	CLIP-seq
MIRT871593	hsa-miR-4802-3p	CLIP-seq
MIRT871595	hsa-miR-487b	CLIP-seq
MIRT871597	hsa-miR-494	CLIP-seq
MIRT871598	hsa-miR-495	CLIP-seq
MIRT871599	hsa-miR-497	CLIP-seq
MIRT871602	hsa-miR-503	CLIP-seq
MIRT871603	hsa-miR-504	CLIP-seq
MIRT871604	hsa-miR-511	CLIP-seq
MIRT871611	hsa-miR-520a-5p	CLIP-seq
MIRT871618	hsa-miR-522	CLIP-seq
MIRT871619	hsa-miR-525-5p	CLIP-seq
MIRT871623	hsa-miR-545	CLIP-seq
MIRT871624	hsa-miR-548a-3p	CLIP-seq
MIRT871625	hsa-miR-548aa	CLIP-seq
MIRT871626	hsa-miR-548ac	CLIP-seq
MIRT871627	hsa-miR-548ad	CLIP-seq
MIRT871628	hsa-miR-548ae	CLIP-seq
MIRT871630	hsa-miR-548aj	CLIP-seq
MIRT871631	hsa-miR-548am	CLIP-seq
MIRT871632	hsa-miR-548c-3p	CLIP-seq
MIRT871633	hsa-miR-548d-3p	CLIP-seq
MIRT871634	hsa-miR-548e	CLIP-seq
MIRT871635	hsa-miR-548f	CLIP-seq
MIRT871637	hsa-miR-548o	CLIP-seq
MIRT871640	hsa-miR-548x	CLIP-seq
MIRT871641	hsa-miR-548z	CLIP-seq
MIRT871643	hsa-miR-552	CLIP-seq
MIRT871646	hsa-miR-564	CLIP-seq
MIRT871647	hsa-miR-569	CLIP-seq
MIRT871650	hsa-miR-584	CLIP-seq
MIRT871654	hsa-miR-599	CLIP-seq
MIRT871655	hsa-miR-600	CLIP-seq
MIRT871658	hsa-miR-606	CLIP-seq
MIRT871664	hsa-miR-625	CLIP-seq
MIRT871665	hsa-miR-628-5p	CLIP-seq
MIRT871668	hsa-miR-636	CLIP-seq
MIRT871671	hsa-miR-641	CLIP-seq
MIRT871672	hsa-miR-644	CLIP-seq
MIRT871674	hsa-miR-655	CLIP-seq
MIRT871679	hsa-miR-668	CLIP-seq
MIRT871681	hsa-miR-873	CLIP-seq
MIRT871683	hsa-miR-889	CLIP-seq
MIRT871686	hsa-miR-942	CLIP-seq
MIRT871302	hsa-let-7a	CLIP-seq
MIRT871303	hsa-let-7b	CLIP-seq
MIRT871304	hsa-let-7c	CLIP-seq
MIRT871305	hsa-let-7d	CLIP-seq
MIRT871306	hsa-let-7e	CLIP-seq
MIRT871307	hsa-let-7f	CLIP-seq
MIRT871308	hsa-let-7g	CLIP-seq
MIRT871309	hsa-let-7i	CLIP-seq
MIRT1958687	hsa-miR-1224-3p	CLIP-seq
MIRT871323	hsa-miR-1245b-3p	CLIP-seq
MIRT871330	hsa-miR-1272	CLIP-seq
MIRT871333	hsa-miR-128	CLIP-seq
MIRT871341	hsa-miR-1322	CLIP-seq
MIRT871346	hsa-miR-140-3p	CLIP-seq
MIRT871347	hsa-miR-147	CLIP-seq
MIRT871349	hsa-miR-150	CLIP-seq
MIRT1958690	hsa-miR-1973	CLIP-seq
MIRT871369	hsa-miR-202	CLIP-seq
MIRT871381	hsa-miR-2278	CLIP-seq
MIRT871390	hsa-miR-3064-3p	CLIP-seq
MIRT871394	hsa-miR-3120-3p	CLIP-seq
MIRT871400	hsa-miR-3135	CLIP-seq
MIRT871402	hsa-miR-3136-3p	CLIP-seq
MIRT871409	hsa-miR-3152-5p	CLIP-seq
MIRT871440	hsa-miR-3607-3p	CLIP-seq
MIRT871446	hsa-miR-3616-5p	CLIP-seq
MIRT871449	hsa-miR-3647-5p	CLIP-seq
MIRT871454	hsa-miR-3673	CLIP-seq
MIRT871455	hsa-miR-3677-5p	CLIP-seq
MIRT871459	hsa-miR-370	CLIP-seq
MIRT871460	hsa-miR-371b-3p	CLIP-seq
MIRT871467	hsa-miR-383	CLIP-seq
MIRT871471	hsa-miR-3911	CLIP-seq
MIRT871486	hsa-miR-4286	CLIP-seq
MIRT871493	hsa-miR-4301	CLIP-seq
MIRT1958692	hsa-miR-4325	CLIP-seq
MIRT871499	hsa-miR-4327	CLIP-seq
MIRT871530	hsa-miR-4648	CLIP-seq
MIRT871561	hsa-miR-4707-3p	CLIP-seq
MIRT871565	hsa-miR-4715-3p	CLIP-seq
MIRT871574	hsa-miR-4753-3p	CLIP-seq
MIRT871591	hsa-miR-4795-5p	CLIP-seq
MIRT871593	hsa-miR-4802-3p	CLIP-seq
MIRT871597	hsa-miR-494	CLIP-seq
MIRT871605	hsa-miR-516b	CLIP-seq
MIRT871606	hsa-miR-518a-5p	CLIP-seq
MIRT871616	hsa-miR-520g	CLIP-seq
MIRT871617	hsa-miR-520h	CLIP-seq
MIRT871622	hsa-miR-527	CLIP-seq
MIRT871626	hsa-miR-548ac	CLIP-seq
MIRT871628	hsa-miR-548ae	CLIP-seq
MIRT871630	hsa-miR-548aj	CLIP-seq
MIRT871631	hsa-miR-548am	CLIP-seq
MIRT871633	hsa-miR-548d-3p	CLIP-seq
MIRT871640	hsa-miR-548x	CLIP-seq
MIRT871641	hsa-miR-548z	CLIP-seq
MIRT871646	hsa-miR-564	CLIP-seq
MIRT871648	hsa-miR-573	CLIP-seq
MIRT871658	hsa-miR-606	CLIP-seq
MIRT871672	hsa-miR-644	CLIP-seq
MIRT871678	hsa-miR-663b	CLIP-seq
MIRT871686	hsa-miR-942	CLIP-seq
MIRT871690	hsa-miR-98	CLIP-seq
MIRT871302	hsa-let-7a	CLIP-seq
MIRT871303	hsa-let-7b	CLIP-seq
MIRT871304	hsa-let-7c	CLIP-seq
MIRT871305	hsa-let-7d	CLIP-seq
MIRT871306	hsa-let-7e	CLIP-seq
MIRT871307	hsa-let-7f	CLIP-seq
MIRT871308	hsa-let-7g	CLIP-seq
MIRT871309	hsa-let-7i	CLIP-seq
MIRT871311	hsa-miR-103b	CLIP-seq
MIRT871317	hsa-miR-1207-5p	CLIP-seq
MIRT1958687	hsa-miR-1224-3p	CLIP-seq
MIRT1958688	hsa-miR-1226	CLIP-seq
MIRT871323	hsa-miR-1245b-3p	CLIP-seq
MIRT871330	hsa-miR-1272	CLIP-seq
MIRT871333	hsa-miR-128	CLIP-seq
MIRT871341	hsa-miR-1322	CLIP-seq
MIRT871343	hsa-miR-1324	CLIP-seq
MIRT871346	hsa-miR-140-3p	CLIP-seq
MIRT871348	hsa-miR-1471	CLIP-seq
MIRT871349	hsa-miR-150	CLIP-seq
MIRT871356	hsa-miR-186	CLIP-seq
MIRT871360	hsa-miR-1908	CLIP-seq
MIRT1958690	hsa-miR-1973	CLIP-seq
MIRT871367	hsa-miR-19a	CLIP-seq
MIRT871368	hsa-miR-19b	CLIP-seq
MIRT871369	hsa-miR-202	CLIP-seq
MIRT871377	hsa-miR-218	CLIP-seq
MIRT871390	hsa-miR-3064-3p	CLIP-seq
MIRT871392	hsa-miR-3065-5p	CLIP-seq
MIRT871398	hsa-miR-3128	CLIP-seq
MIRT1958691	hsa-miR-3133	CLIP-seq
MIRT871400	hsa-miR-3135	CLIP-seq
MIRT871402	hsa-miR-3136-3p	CLIP-seq
MIRT871407	hsa-miR-3151	CLIP-seq
MIRT871409	hsa-miR-3152-5p	CLIP-seq
MIRT871416	hsa-miR-3180	CLIP-seq
MIRT871417	hsa-miR-3180-3p	CLIP-seq
MIRT871425	hsa-miR-3196	CLIP-seq
MIRT871427	hsa-miR-3201	CLIP-seq
MIRT871431	hsa-miR-329	CLIP-seq
MIRT871440	hsa-miR-3607-3p	CLIP-seq
MIRT871445	hsa-miR-361-5p	CLIP-seq
MIRT871446	hsa-miR-3616-5p	CLIP-seq
MIRT2498771	hsa-miR-3621	CLIP-seq
MIRT871448	hsa-miR-362-3p	CLIP-seq
MIRT871449	hsa-miR-3647-5p	CLIP-seq
MIRT2498772	hsa-miR-3656	CLIP-seq
MIRT2195430	hsa-miR-3663-3p	CLIP-seq
MIRT871455	hsa-miR-3677-5p	CLIP-seq
MIRT871459	hsa-miR-370	CLIP-seq
MIRT871460	hsa-miR-371b-3p	CLIP-seq
MIRT871466	hsa-miR-376c	CLIP-seq
MIRT871467	hsa-miR-383	CLIP-seq
MIRT871472	hsa-miR-3918	CLIP-seq
MIRT871477	hsa-miR-3938	CLIP-seq
MIRT871479	hsa-miR-421	CLIP-seq
MIRT871486	hsa-miR-4286	CLIP-seq
MIRT871487	hsa-miR-4287	CLIP-seq
MIRT871489	hsa-miR-4290	CLIP-seq
MIRT871493	hsa-miR-4301	CLIP-seq
MIRT871495	hsa-miR-4307	CLIP-seq
MIRT1958692	hsa-miR-4325	CLIP-seq
MIRT871499	hsa-miR-4327	CLIP-seq
MIRT1958693	hsa-miR-4436b-3p	CLIP-seq
MIRT871516	hsa-miR-4494	CLIP-seq
MIRT871529	hsa-miR-4632	CLIP-seq
MIRT871540	hsa-miR-4662a-5p	CLIP-seq
MIRT871552	hsa-miR-4685-3p	CLIP-seq
MIRT1958695	hsa-miR-4685-5p	CLIP-seq
MIRT871561	hsa-miR-4707-3p	CLIP-seq
MIRT871565	hsa-miR-4715-3p	CLIP-seq
MIRT1958696	hsa-miR-4722-3p	CLIP-seq
MIRT871567	hsa-miR-4725-5p	CLIP-seq
MIRT2498773	hsa-miR-4734	CLIP-seq
MIRT1958697	hsa-miR-4755-3p	CLIP-seq
MIRT871576	hsa-miR-4757-5p	CLIP-seq
MIRT871578	hsa-miR-4763-3p	CLIP-seq
MIRT2195432	hsa-miR-4781-5p	CLIP-seq
MIRT871589	hsa-miR-4791	CLIP-seq
MIRT871590	hsa-miR-4793-5p	CLIP-seq
MIRT871591	hsa-miR-4795-5p	CLIP-seq
MIRT871592	hsa-miR-4796-5p	CLIP-seq
MIRT871593	hsa-miR-4802-3p	CLIP-seq
MIRT871596	hsa-miR-490-5p	CLIP-seq
MIRT871600	hsa-miR-499a-5p	CLIP-seq
MIRT871603	hsa-miR-504	CLIP-seq
MIRT871605	hsa-miR-516b	CLIP-seq
MIRT871606	hsa-miR-518a-5p	CLIP-seq
MIRT871616	hsa-miR-520g	CLIP-seq
MIRT871617	hsa-miR-520h	CLIP-seq
MIRT871618	hsa-miR-522	CLIP-seq
MIRT871622	hsa-miR-527	CLIP-seq
MIRT1958698	hsa-miR-541	CLIP-seq
MIRT871624	hsa-miR-548a-3p	CLIP-seq
MIRT871625	hsa-miR-548aa	CLIP-seq
MIRT871626	hsa-miR-548ac	CLIP-seq
MIRT871628	hsa-miR-548ae	CLIP-seq
MIRT871630	hsa-miR-548aj	CLIP-seq
MIRT871631	hsa-miR-548am	CLIP-seq
MIRT871632	hsa-miR-548c-3p	CLIP-seq
MIRT871633	hsa-miR-548d-3p	CLIP-seq
MIRT871634	hsa-miR-548e	CLIP-seq
MIRT871635	hsa-miR-548f	CLIP-seq
MIRT871640	hsa-miR-548x	CLIP-seq
MIRT871641	hsa-miR-548z	CLIP-seq
MIRT871646	hsa-miR-564	CLIP-seq
MIRT871648	hsa-miR-573	CLIP-seq
MIRT871656	hsa-miR-602	CLIP-seq
MIRT871658	hsa-miR-606	CLIP-seq
MIRT871668	hsa-miR-636	CLIP-seq
MIRT2498774	hsa-miR-639	CLIP-seq
MIRT1958700	hsa-miR-654-5p	CLIP-seq
MIRT1958701	hsa-miR-659	CLIP-seq
MIRT871677	hsa-miR-663	CLIP-seq
MIRT871678	hsa-miR-663b	CLIP-seq
MIRT2195433	hsa-miR-665	CLIP-seq
MIRT871679	hsa-miR-668	CLIP-seq
MIRT2498775	hsa-miR-720	CLIP-seq
MIRT871681	hsa-miR-873	CLIP-seq
MIRT871682	hsa-miR-885-5p	CLIP-seq
MIRT871685	hsa-miR-938	CLIP-seq
MIRT2195434	hsa-miR-939	CLIP-seq
MIRT871690	hsa-miR-98	CLIP-seq
MIRT871302	hsa-let-7a	CLIP-seq
MIRT871303	hsa-let-7b	CLIP-seq
MIRT871304	hsa-let-7c	CLIP-seq
MIRT871305	hsa-let-7d	CLIP-seq
MIRT871306	hsa-let-7e	CLIP-seq
MIRT871307	hsa-let-7f	CLIP-seq
MIRT871308	hsa-let-7g	CLIP-seq
MIRT871309	hsa-let-7i	CLIP-seq
MIRT871317	hsa-miR-1207-5p	CLIP-seq
MIRT1958687	hsa-miR-1224-3p	CLIP-seq
MIRT1958688	hsa-miR-1226	CLIP-seq
MIRT871323	hsa-miR-1245b-3p	CLIP-seq
MIRT871330	hsa-miR-1272	CLIP-seq
MIRT871333	hsa-miR-128	CLIP-seq
MIRT871341	hsa-miR-1322	CLIP-seq
MIRT871343	hsa-miR-1324	CLIP-seq
MIRT871346	hsa-miR-140-3p	CLIP-seq
MIRT871348	hsa-miR-1471	CLIP-seq
MIRT871349	hsa-miR-150	CLIP-seq
MIRT871356	hsa-miR-186	CLIP-seq
MIRT1958690	hsa-miR-1973	CLIP-seq
MIRT871367	hsa-miR-19a	CLIP-seq
MIRT871368	hsa-miR-19b	CLIP-seq
MIRT871369	hsa-miR-202	CLIP-seq
MIRT871377	hsa-miR-218	CLIP-seq
MIRT871390	hsa-miR-3064-3p	CLIP-seq
MIRT871392	hsa-miR-3065-5p	CLIP-seq
MIRT1958691	hsa-miR-3133	CLIP-seq
MIRT871400	hsa-miR-3135	CLIP-seq
MIRT871402	hsa-miR-3136-3p	CLIP-seq
MIRT871407	hsa-miR-3151	CLIP-seq
MIRT871409	hsa-miR-3152-5p	CLIP-seq
MIRT871416	hsa-miR-3180	CLIP-seq
MIRT871417	hsa-miR-3180-3p	CLIP-seq
MIRT871425	hsa-miR-3196	CLIP-seq
MIRT871427	hsa-miR-3201	CLIP-seq
MIRT871431	hsa-miR-329	CLIP-seq
MIRT871440	hsa-miR-3607-3p	CLIP-seq
MIRT871445	hsa-miR-361-5p	CLIP-seq
MIRT871446	hsa-miR-3616-5p	CLIP-seq
MIRT871448	hsa-miR-362-3p	CLIP-seq
MIRT871449	hsa-miR-3647-5p	CLIP-seq
MIRT871455	hsa-miR-3677-5p	CLIP-seq
MIRT871459	hsa-miR-370	CLIP-seq
MIRT871460	hsa-miR-371b-3p	CLIP-seq
MIRT871467	hsa-miR-383	CLIP-seq
MIRT871472	hsa-miR-3918	CLIP-seq
MIRT871477	hsa-miR-3938	CLIP-seq
MIRT871479	hsa-miR-421	CLIP-seq
MIRT871486	hsa-miR-4286	CLIP-seq
MIRT871487	hsa-miR-4287	CLIP-seq
MIRT871489	hsa-miR-4290	CLIP-seq
MIRT871493	hsa-miR-4301	CLIP-seq
MIRT1958692	hsa-miR-4325	CLIP-seq
MIRT871499	hsa-miR-4327	CLIP-seq
MIRT1958693	hsa-miR-4436b-3p	CLIP-seq
MIRT871529	hsa-miR-4632	CLIP-seq
MIRT871536	hsa-miR-4655-5p	CLIP-seq
MIRT871552	hsa-miR-4685-3p	CLIP-seq
MIRT1958695	hsa-miR-4685-5p	CLIP-seq
MIRT871561	hsa-miR-4707-3p	CLIP-seq
MIRT871565	hsa-miR-4715-3p	CLIP-seq
MIRT1958696	hsa-miR-4722-3p	CLIP-seq
MIRT871567	hsa-miR-4725-5p	CLIP-seq
MIRT1958697	hsa-miR-4755-3p	CLIP-seq
MIRT871576	hsa-miR-4757-5p	CLIP-seq
MIRT871578	hsa-miR-4763-3p	CLIP-seq
MIRT2195432	hsa-miR-4781-5p	CLIP-seq
MIRT871589	hsa-miR-4791	CLIP-seq
MIRT871591	hsa-miR-4795-5p	CLIP-seq
MIRT871593	hsa-miR-4802-3p	CLIP-seq
MIRT871596	hsa-miR-490-5p	CLIP-seq
MIRT871603	hsa-miR-504	CLIP-seq
MIRT871605	hsa-miR-516b	CLIP-seq
MIRT871606	hsa-miR-518a-5p	CLIP-seq
MIRT871616	hsa-miR-520g	CLIP-seq
MIRT871617	hsa-miR-520h	CLIP-seq
MIRT871622	hsa-miR-527	CLIP-seq
MIRT871624	hsa-miR-548a-3p	CLIP-seq
MIRT871626	hsa-miR-548ac	CLIP-seq
MIRT871628	hsa-miR-548ae	CLIP-seq
MIRT871630	hsa-miR-548aj	CLIP-seq
MIRT871631	hsa-miR-548am	CLIP-seq
MIRT871632	hsa-miR-548c-3p	CLIP-seq
MIRT871633	hsa-miR-548d-3p	CLIP-seq
MIRT871634	hsa-miR-548e	CLIP-seq
MIRT871635	hsa-miR-548f	CLIP-seq
MIRT871640	hsa-miR-548x	CLIP-seq
MIRT871641	hsa-miR-548z	CLIP-seq
MIRT871646	hsa-miR-564	CLIP-seq
MIRT871648	hsa-miR-573	CLIP-seq
MIRT871658	hsa-miR-606	CLIP-seq
MIRT871668	hsa-miR-636	CLIP-seq
MIRT1958701	hsa-miR-659	CLIP-seq
MIRT871678	hsa-miR-663b	CLIP-seq
MIRT2195433	hsa-miR-665	CLIP-seq
MIRT871681	hsa-miR-873	CLIP-seq
MIRT871682	hsa-miR-885-5p	CLIP-seq
MIRT871685	hsa-miR-938	CLIP-seq
MIRT871690	hsa-miR-98	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
AHR	Unknown	24380854
ATF2	Activation	10464245;10915780
BHLHE41	Repression	18223678
BRCA1	Unknown	12032322
BTG2	Repression	15870875;16849553
CTCF	Unknown	18625744
CTNNB1	Activation	17109766;20300972
CTNNB1	Repression	16628468
CTNNB1	Unknown	18679417;19662654;19778454
E2F1	Activation	20220142;20655656;8618861
E2F1	Unknown	19876926;22768064;8137237;9584162
E2F4	Unknown	9584162
E2F8	Unknown	20068156
EGR1	Activation	11502738
EGR1	Unknown	20590664
EP300	Unknown	20101207
ESR1	Activation	12554765;15178330;17681750
ESR1	Unknown	12929585;22892083
EZH2	Activation	20132185;21697275
FHL2	Repression	21377781
FOS	Repression	20188076;21474819
HDAC1	Activation	20049841
HDAC1	Repression	20821348
HEXIM1	Repression	18757415
HIF1A	Repression	20179204
HOXA1	Activation	15665309
HOXB7	Activation	21474578
ING4	Repression	18399550
JUN	Activation	10500157;16393119;19435822;20220142
JUN	Repression	21474819
JUN	Unknown	14672732
JUND	Activation	20220142
KDM4B	Unknown	20682797
KLF4	Activation	21132436;21224073
KLF4	Repression	10908361;19737957
KLF5	Activation	19189969
KLF6	Repression	18822210
LEF1	Unknown	10318916;19620402
LIN28A	Unknown	22467868
MECP2	Repression	15870696
MYBL2	Unknown	15922873
MYC	Repression	14757441;8196642
MYC	Unknown	17881732;18809243;19698176;21933022
NANOG	Unknown	22381696
NELFCD	Repression	20735431
NFKB1	Activation	10464245;11861406;15756023;15856023;17407600;18341653;19263436;22306268
NFKB1	Repression	18566231
NFKB1	Unknown	10409765;12894581;16453001;17673602;17944672;18184402;19766095;20103608;20538607
NKX3-1	Repression	22179513
NPM1	Unknown	18625744
NR3C1	Unknown	18097517
PAX5	Repression	22105368
PGR	Unknown	22542550;22892083
PML	Repression	15529177
POU2F1	Activation	12391146
POU4F2	Activation	17637757
PPARG	Repression	15041706;15193259;15486348
RELA	Activation	10409765;10464245;11861406;15756023;15856023;17407600;18341653;19263436;22306268
RELA	Repression	18566231
RELA	Unknown	12894581;16453001;17673602;17944672;18184402;19766095;20103608;20538607
RNF14	Activation	17510080
RUNX3	Repression	15930301
SIRT1	Repression	21474819
SMARCA4	Repression	18239461
SNIP1	Unknown	17260016
SOX2	Unknown	18456656
SOX6	Repression	21084391
SP1	Activation	19755513
SP1	Unknown	10908361;11024050;22334592;22415074
SP3	Unknown	22334592
SP4	Unknown	22334592
STAT3	Activation	16651438;19880237;19926637;21435102;22218594
STAT3	Repression	19880237;22313388
STAT3	Unknown	12147685;15469392;16384639;16510571;18184402;20332458;21172343;21344490
STAT5A	Unknown	14645506
STAT5B	Unknown	14645506
TCF4	Activation	20459685
TCF4	Unknown	19662654;19778454
TP53	Repression	12808109
TSC22D3	Activation	19814803
VHL	Unknown	19238077
ZNF24	Activation	22213192

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000082	Process	G1/S transition of mitotic cell cycle	IBA
GO:0000082	Process	G1/S transition of mitotic cell cycle	IDA	8114739, 19237565
GO:0000082	Process	G1/S transition of mitotic cell cycle	IDA	19412162, 33854232, 33854235, 33854239
GO:0000082	Process	G1/S transition of mitotic cell cycle	IEA
GO:0000082	Process	G1/S transition of mitotic cell cycle	IEA
GO:0000082	Process	G1/S transition of mitotic cell cycle	NAS	7603984, 8114739
GO:0000082	Process	G1/S transition of mitotic cell cycle	TAS	18483258, 33854239
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	16569215, 18417529
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000307	Component	Cyclin-dependent protein kinase holoenzyme complex	IBA
GO:0000307	Component	Cyclin-dependent protein kinase holoenzyme complex	IDA	8114739, 17420273
GO:0000307	Component	Cyclin-dependent protein kinase holoenzyme complex	IEA
GO:0000320	Process	Re-entry into mitotic cell cycle	IEA
GO:0001889	Process	Liver development	IEA
GO:0003714	Function	Transcription corepressor activity	IDA	16569215, 18417529
GO:0004672	Function	Protein kinase activity	IEA
GO:0005515	Function	Protein binding	IPI	7568034, 8756624, 9106657, 9840943, 15232106, 15681588, 16431923, 16461912, 16569215, 16864783, 17254966, 17334399, 17517622, 19124461, 19237565, 19409388, 19412162, 19470470, 20399237, 20439707, 21242975, 21516116, 21952639, 21988832, 23455922, 23543736, 24218572, 24855949, 2524176
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	11793365, 20399237, 29279382
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	29279382
GO:0005737	Component	Cytoplasm	IEA
GO:0005815	Component	Microtubule organizing center	IBA
GO:0005829	Component	Cytosol	TAS
GO:0005923	Component	Bicellular tight junction	IEA
GO:0006974	Process	DNA damage response	IDA	19412162
GO:0006974	Process	DNA damage response	IEA
GO:0007595	Process	Lactation	IEA
GO:0008283	Process	Cell population proliferation	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	IEA
GO:0009410	Process	Response to xenobiotic stimulus	IEA
GO:0009410	Process	Response to xenobiotic stimulus	IEP	18291362
GO:0010039	Process	Response to iron ion	IEA
GO:0010165	Process	Response to X-ray	IEA
GO:0010971	Process	Positive regulation of G2/M transition of mitotic cell cycle	IDA	19124461
GO:0016020	Component	Membrane	IEA
GO:0016055	Process	Wnt signaling pathway	IEA
GO:0016301	Function	Kinase activity	IEA
GO:0016538	Function	Cyclin-dependent protein serine/threonine kinase regulator activity	IBA
GO:0016538	Function	Cyclin-dependent protein serine/threonine kinase regulator activity	IEA
GO:0017053	Component	Transcription repressor complex	IDA	16569215, 18417529
GO:0019899	Function	Enzyme binding	IPI	19412162
GO:0019901	Function	Protein kinase binding	IEA
GO:0019901	Function	Protein kinase binding	IPI	8114739, 19124461
GO:0030182	Process	Neuron differentiation	IEA
GO:0030857	Process	Negative regulation of epithelial cell differentiation	IEA
GO:0030968	Process	Endoplasmic reticulum unfolded protein response	IEA
GO:0031100	Process	Animal organ regeneration	IEA
GO:0031571	Process	Mitotic G1 DNA damage checkpoint signaling	IDA	19412162
GO:0031965	Component	Nuclear membrane	IEA
GO:0032026	Process	Response to magnesium ion	IEA
GO:0032355	Process	Response to estradiol	IEA
GO:0033197	Process	Response to vitamin E	IEA
GO:0033327	Process	Leydig cell differentiation	IEA
GO:0033598	Process	Mammary gland epithelial cell proliferation	IEA
GO:0033601	Process	Positive regulation of mammary gland epithelial cell proliferation	IEA
GO:0042826	Function	Histone deacetylase binding	IPI	18417529
GO:0043524	Process	Negative regulation of neuron apoptotic process	IEA
GO:0043539	Function	Protein serine/threonine kinase activator activity	IDA	8114739
GO:0043627	Process	Response to estrogen	IEA
GO:0044321	Process	Response to leptin	IDA	17344214
GO:0044877	Function	Protein-containing complex binding	IEA
GO:0045444	Process	Fat cell differentiation	IEA
GO:0045471	Process	Response to ethanol	IEA
GO:0048545	Process	Response to steroid hormone	IEA
GO:0051301	Process	Cell division	IEA
GO:0051384	Process	Response to glucocorticoid	IEA
GO:0051412	Process	Response to corticosterone	IEA
GO:0051592	Process	Response to calcium ion	IEA
GO:0051726	Process	Regulation of cell cycle	IEA
GO:0060749	Process	Mammary gland alveolus development	IEA
GO:0061575	Function	Cyclin-dependent protein serine/threonine kinase activator activity	IDA	19237565
GO:0061575	Function	Cyclin-dependent protein serine/threonine kinase activator activity	IEA
GO:0061575	Function	Cyclin-dependent protein serine/threonine kinase activator activity	TAS	33854239
GO:0070064	Function	Proline-rich region binding	IDA	19124461
GO:0070141	Process	Response to UV-A	IDA	18483258
GO:0097128	Component	Cyclin D1-CDK4 complex	IEA
GO:0097128	Component	Cyclin D1-CDK4 complex	IPI	19237565
GO:0097131	Component	Cyclin D1-CDK6 complex	IPI	15232106
GO:0097421	Process	Liver regeneration	IEA
GO:1900087	Process	Positive regulation of G1/S transition of mitotic cell cycle	IBA
GO:1901992	Process	Positive regulation of mitotic cell cycle phase transition	IEA
GO:2000045	Process	Regulation of G1/S transition of mitotic cell cycle	IEA
GO:2000045	Process	Regulation of G1/S transition of mitotic cell cycle	IEA

Other IDs

• MIM: 168461
• HGNC: 1582
• e!Ensembl: ENSG00000110092

Protein

• UniProt ID: P24385
• Protein name: G1/S-specific cyclin-D1 (B-cell lymphoma 1 protein) (BCL-1) (BCL-1 oncogene) (PRAD1 oncogene)
• Protein function: Regulatory component of the cyclin D1-CDK4 (DC) complex that phosphorylates and inhibits members of the retinoblastoma (RB) protein family including RB1 and regulates the cell-cycle during G(1)/S transition (PubMed:1827756, PubMed:1833066, PubMe
• PDB: 2W96, 2W99, 2W9F, 2W9Z, 5VZU, 6P8E, 6P8F, 6P8G, 6P8H
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00134	Cyclin_N	26 → 153	Cyclin, N-terminal domain	Domain
  PF02984	Cyclin_C	155 → 282	Cyclin, C-terminal domain	Domain

• Sequence:

  MEHQLLCCEVETIRRAYPDANLLNDRVLRAMLKAEETCAPSVSYFKCVQKEVLPSMRKIV
  ATWMLEVCEEQKCEEEVFPLAMNYLDRFLSLEPVKKSRLQLLGATCMFVASKMKETIPLT
  AEKLCIYTDNSIRPEELLQMELLLVNKLKWNLAAMTPHDFIEHFLSKMPEAEENKQIIRK
  HAQTFVALCATDVKFISNPPSMVAAGSVVAAVQGLNLRSPNNFLSYYRLTRFLSRVIKCD
  PDCLRACQEQIEALLESSLRQAQQNMDPKAAEEEEEEEEEVDLACTPTDVRDVDI

• Sequence length: 295

Pathways

KEGG:

Endocrine resistance
FoxO signaling pathway
Cell cycle
p53 signaling pathway
PI3K-Akt signaling pathway
AMPK signaling pathway
Cellular senescence
Wnt signaling pathway
Hedgehog signaling pathway
Apelin signaling pathway
Hippo signaling pathway
Focal adhesion
Tight junction
JAK-STAT signaling pathway
Prolactin signaling pathway
Thyroid hormone signaling pathway
Oxytocin signaling pathway
AGE-RAGE signaling pathway in diabetic complications
Cushing syndrome
Alcoholic liver disease
Hepatitis C
Measles
Human cytomegalovirus infection
Human papillomavirus infection
Human T-cell leukemia virus 1 infection
Kaposi sarcoma-associated herpesvirus infection
Epstein-Barr virus infection
Pathways in cancer
Viral carcinogenesis
Proteoglycans in cancer
MicroRNAs in cancer
Chemical carcinogenesis - receptor activation
Colorectal cancer
Pancreatic cancer
Endometrial cancer
Glioma
Prostate cancer
Thyroid cancer
Melanoma
Bladder cancer
Chronic myeloid leukemia
Acute myeloid leukemia
Small cell lung cancer
Non-small cell lung cancer
Breast cancer
Hepatocellular carcinoma
Gastric cancer
Viral myocarditis

Reactome:

SCF(Skp2)-mediated degradation of p27/p21
RMTs methylate histone arginines
Interleukin-4 and Interleukin-13 signaling
Cyclin D associated events in G1
Ubiquitin-dependent degradation of Cyclin D
PTK6 Regulates Cell Cycle
Transcriptional Regulation by VENTX
Transcriptional regulation by RUNX2
Regulation of RUNX1 Expression and Activity
RUNX3 regulates WNT signaling
RUNX3 regulates p14-ARF
Estrogen-dependent gene expression
Estrogen-dependent nuclear events downstream of ESR-membrane signaling

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
B-CELL CHRONIC LYMPHOCYTIC LEUKEMIA	—	Orphanet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BOWEN'S DISEASE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BRAIN NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, ADENOID CYSTIC	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, HEPATOCELLULAR	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, SQUAMOUS CELL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, TRANSITIONAL CELL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CCND1-related disorder	Benign; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CECAL NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLONIC NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL CANCER	—	ClinVar, GWAS catalog ClinVar, GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal cancer, susceptibility to	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETIC EYE DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETIC RETINOPATHY	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENDOMETRIAL NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESOPHAGEAL NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESOPHAGEAL SQUAMOUS CELL CARCINOMA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESTROGEN-RECEPTOR NEGATIVE BREAST CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FAMILIAL LONG QT SYNDROME	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEMANGIOSARCOMA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERPARATHYROIDISM	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERPLASIA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INTESTINAL POLYPS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
KIDNEY NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEUKEMIA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER NEOPLASMS, EXPERIMENTAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG ADENOCARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE MYELOMA	—	CTD, ClinVar, GWAS catalog, Orphanet CTD, ClinVar, GWAS catalog, Orphanet CTD, ClinVar, GWAS catalog, Orphanet CTD, ClinVar, GWAS catalog, Orphanet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE MYELOMA, t(11;14) TYPE, SUSCEPTIBILITY TO	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL ISCHEMIA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NASOPHARYNGEAL CARCINOMA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN ENDOMETRIOID CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN SEROUS CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PAPILLOMA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATIC NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SALIVARY GLAND NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SQUAMOUS CELL CARCINOMA OF HEAD AND NECK	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SQUAMOUS CELL LUNG CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STOMACH NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
THYROID NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UNIPOLAR DEPRESSION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
URINARY BLADDER NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UROLOGIC NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UTERINE CERVICAL NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VON HIPPEL-LINDAU DISEASE	—	CTD, GWAS catalog, Orphanet CTD, GWAS catalog, Orphanet CTD, GWAS catalog, Orphanet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VON HIPPEL-LINDAU SYNDROME	—	ClinVar, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
VON HIPPEL-LINDAU SYNDROME, MODIFIER OF	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Achondroplasia	Achondroplasia	BEFREE	19802676		★☆☆☆☆ Found in Text Mining only
Achondroplasia	Achondroplasia	Pubtator	19802676	Stimulate	★☆☆☆☆ Found in Text Mining only
Acoustic Neuroma	Acoustic Neuroma	BEFREE	17684142, 17704717, 17989580, 20600642, 26165351		★☆☆☆☆ Found in Text Mining only
ACTH-Secreting Pituitary Adenoma	Pituitary adenoma	BEFREE	20616110, 30474823		★☆☆☆☆ Found in Text Mining only
Acute leukemia	Leukemia	BEFREE	16522546		★☆☆☆☆ Found in Text Mining only
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	10216470, 12537975, 12972956, 16207592, 16522546, 18032022, 23613410, 27050122, 9355972		★☆☆☆☆ Found in Text Mining only
Acute Myeloid Leukemia (AML-M2)	Leukemia	BEFREE	17213025		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	10371338, 10419705, 10680670, 10944553, 12209953, 14581353, 14592662, 15378768, 15993030, 16163549, 17922974, 19706803, 21390188, 21400612, 2170896, 22024187, 26246306, 26681199, 27498289, 28052061, 28634225, 28943959, 29969496, 30903019, 8208295, 8781742, 9759649, 9815783		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	LHGDN	12209953, 12606305, 16815198, 17600882, 19047108		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	CTD_human_DG	26432044		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma Of Esophagus	Esophageal Cancer	BEFREE	10944553, 15297940, 15971196, 17308274, 18665038, 19302219, 24206575		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of large intestine	Colorectal Cancer	BEFREE	17587243, 29683067		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	15289739, 16230611, 24972691, 26676638, 26681199, 26884860, 27151654, 28423618, 28979806, 29311567		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of pancreas	Pancreatic adenocarcinoma	BEFREE	25053516, 9134998		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of prostate	Prostate adenocarcinoma	BEFREE	26246306		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Basal Cell	Adenocarcinoma	CTD_human_DG	26432044		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Endometrioid	Endometrial Cancer	BEFREE	15213599		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Oxyphilic	Adenocarcinoma	CTD_human_DG	26432044		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma, Tubular	Adenocarcinoma	CTD_human_DG	26432044		★☆☆☆☆ Found in Text Mining only
Adenoid Cystic Carcinoma	Adenocarcinoma	BEFREE	10928172, 15943036		★☆☆☆☆ Found in Text Mining only
Adenoid Cystic Carcinoma	Adenocarcinoma	CTD_human_DG	16762588		★☆☆☆☆ Found in Text Mining only
Adenoid Cystic Carcinoma	Adenocarcinoma	LHGDN	16865250		★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	10680670, 11288983, 11290553, 12530096, 14694525, 15757864, 16495921, 17468190, 18684024, 19373510, 21107342, 21738001, 23660642, 24035866, 24373949, 24510244, 27479195, 8626826, 9626345		★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	LHGDN	17693985, 17927591		★☆☆☆☆ Found in Text Mining only
Adenoma of large intestine	Colorectal adenoma	BEFREE	14679024		★☆☆☆☆ Found in Text Mining only
Adenomatous Polyposis Coli	Multiple polyposis syndrome	BEFREE	11592102, 11836553, 12174906, 14679024, 17676483, 19415698, 19749785, 21752055, 23087084, 23771323, 28866416, 31364752, 31423241		★☆☆☆☆ Found in Text Mining only
Adenomatous Polyposis Coli	Multiple polyposis syndrome	LHGDN	12036951, 17090192		★☆☆☆☆ Found in Text Mining only
Adrenal Gland Pheochromocytoma	Adrenal Gland Pheochromocytoma	BEFREE	12097293, 16954163, 20621999, 24390213		★☆☆☆☆ Found in Text Mining only
Adrenocortical Carcinoma	Adrenocortical carcinoma	Pubtator	24755523	Associate	★☆☆☆☆ Found in Text Mining only
Adrenocortical carcinoma	Adrenocortical carcinoma	BEFREE	28095038		★☆☆☆☆ Found in Text Mining only
Adult Acute Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	10216470, 10699895, 12537975, 16207592, 16522546, 23613410		★☆☆☆☆ Found in Text Mining only
Adult Diffuse Large B-Cell Lymphoma	B-cell Lymphoma	BEFREE	10803523, 11697627, 20062012, 21281227, 21334716, 25596256, 26034867, 28296741		★☆☆☆☆ Found in Text Mining only
Adult Hepatocellular Carcinoma	Liver carcinoma	BEFREE	17546056		★☆☆☆☆ Found in Text Mining only
Adult Malignant Peripheral Nerve Sheath Tumor	Malignant Peripheral Nerve Sheath Tumor	BEFREE	29332262		★☆☆☆☆ Found in Text Mining only
Adult Medulloblastoma	Medulloblastoma	BEFREE	19147556, 22682621, 27966820, 28856557, 28915627		★☆☆☆☆ Found in Text Mining only
Adult T-Cell Lymphoma/Leukemia	T-Cell Lymphoma/Leukemia	BEFREE	11992406, 20101207		★☆☆☆☆ Found in Text Mining only
Agenesis of corpus callosum	Agenesis Of Corpus Callosum	BEFREE	10928172, 15943036, 17113340, 29430168		★☆☆☆☆ Found in Text Mining only
Aicardi Syndrome	Aicardi syndrome	Pubtator	29430168	Associate	★☆☆☆☆ Found in Text Mining only
AICARDI-GOUTIERES SYNDROME	Aicardi Goutieres Syndrome	BEFREE	11349065, 31792359		★☆☆☆☆ Found in Text Mining only
Alveolar rhabdomyosarcoma	Alveolar Rhabdomyosarcoma	BEFREE	26363896, 27425595		★☆☆☆☆ Found in Text Mining only
Ameloblastoma	Ameloblastoma	BEFREE	18284543, 24930892		★☆☆☆☆ Found in Text Mining only
Ameloblastoma	Ameloblastoma	Pubtator	20383104, 25991665	Associate	★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	BEFREE	22100494		★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	22426476		★☆☆☆☆ Found in Text Mining only
Anaplasia	Anaplasia	BEFREE	11495045, 19303206, 23324130, 29489901		★☆☆☆☆ Found in Text Mining only
Anaplastic astrocytoma	Anaplastic Astrocytoma	BEFREE	10416984		★☆☆☆☆ Found in Text Mining only
Anaplastic carcinoma	Anaplastic Carcinoma	CTD_human_DG	12376462, 14522882, 16316942, 17173897		★☆☆☆☆ Found in Text Mining only
Anaplastic Oligodendroglioma	Anaplastic Oligodendroglioma	BEFREE	29489901		★☆☆☆☆ Found in Text Mining only
Anaplastic thyroid carcinoma	Anaplastic thyroid cancer	BEFREE	15650354, 18753363		★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Aneuploidy	Aneuploidy	Pubtator	21537090	Associate	★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	17600882, 20113529, 28138026, 30405764, 31837005		★☆☆☆☆ Found in Text Mining only
Anorexia	Anorexia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Anus Neoplasms	Anus Neoplasms	BEFREE	9042789		★☆☆☆☆ Found in Text Mining only
Aortic Valve Insufficiency	Aortic Valve Insufficiency	BEFREE	21212260		★☆☆☆☆ Found in Text Mining only
Apert syndrome	Apert Syndrome	BEFREE	23726368		★☆☆☆☆ Found in Text Mining only
Aplasia Cutis Congenita	Aplasia Cutis Congenita	BEFREE	10928172, 15943036, 17113340, 29430168		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	31048182		★☆☆☆☆ Found in Text Mining only
Arthritis Psoriatic	Psoriatic arthritis	Pubtator	29115643	Stimulate	★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	21676922	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis, Psoriatic	Psoriatic Arthritis	BEFREE	21185249		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	20426528, 33068389, 34182479, 35396910	Associate	★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	21113676, 23311506, 25982579		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	34182479	Stimulate	★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	10416984, 30941985	Stimulate	★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	10419598, 18156430, 19513548, 19576519, 22542550, 26654598, 28418872, 30562739, 8857999		★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	19143767, 23991960, 26317630, 26654598, 28418872, 30562739	Associate	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	31048182		★☆☆☆☆ Found in Text Mining only
Atypical Ductal Breast Hyperplasia	Breast Hyperplasia	BEFREE	10066068		★☆☆☆☆ Found in Text Mining only
Atypical Teratoid Rhabdoid Tumor	Teratoid Rhabdoid Tumor	BEFREE	12138206, 15981100, 27966820		★☆☆☆☆ Found in Text Mining only
B-cell chronic lymphocytic leukemia	Lymphocytic Leukemia	Orphanet			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	10602433, 10733493, 10896772, 11260626, 12683869, 1493447, 15239399, 15900590, 16183118, 16712476, 1682919, 1757070, 17607588, 1765644, 19321861, 19880778, 19966855, 20038219, 20727381, 2078513, 21325634, 21345142, 21504716, 21606168, 21912938, 2249841, 22555177, 23754783, 23867991, 24060591, 24166616, 24722063, 25037230, 25124606, 25572145, 25944379, 26035694, 26136223, 26439697, 26699502, 27458102, 27864821, 2787901, 28069005, 28140709, 28296741, 28376129, 28617558, 28974340, 29042957, 29344161, 29352223, 29403080, 29725418, 29749523, 31115494, 31637187, 31786879, 31822509, 3259659, 7531681, 7675778, 7918073, 8062825, 8302597, 8364907, 8492222, 8774476, 9001420, 9028966, 9209653, 9234379, 9324302, 9376597, 9546285, 9772907		★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	LHGDN	17607588, 18343791		★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	HPO_DG			★☆☆☆☆ Found in Text Mining only
B-CELL MALIGNANCY, LOW-GRADE	Lymphocytic Leukemia	BEFREE	8102560, 8203469, 9250825		★☆☆☆☆ Found in Text Mining only
B-CELL MALIGNANCY, LOW-GRADE	Lymphocytic Leukemia	ORPHANET_DG			★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	BEFREE	10944553, 16163549, 17308274, 18430189, 21791690, 23771323, 8781742		★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	Pubtator	15971196, 19147768, 26297437	Associate	★☆☆☆☆ Found in Text Mining only
Basal Cell Nevus Syndrome	Basal Cell Neoplasm	BEFREE	10403462		★☆☆☆☆ Found in Text Mining only
Benign Neoplasm	Benign Neoplasm	BEFREE	11288983, 15545188, 15646810, 2011400, 22535643		★☆☆☆☆ Found in Text Mining only
Benign neoplasm of brain, unspecified	Brain Neoplasms	CTD_human_DG	20932960, 27935819		★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	29633291		★☆☆☆☆ Found in Text Mining only
Beta ketothiolase deficiency	Beta-ketothiolase deficiency	Pubtator	26449430	Associate	★☆☆☆☆ Found in Text Mining only
Biliary Atresia	Biliary atresia	Pubtator	33060611	Associate	★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	10473073, 12237776, 12372886, 12896908, 14648664, 15245939, 15390184, 15590562, 15897688, 18361427, 20540739, 20575692, 21705050, 21766505, 21789902, 23887292, 23893383, 24264314, 24324055, 25556372, 25888950, 28109084, 30104251, 30387807, 30446453, 31164795, 8622895, 9738978, 9815621		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	LHGDN	12394763, 15245939		★☆☆☆☆ Found in Text Mining only
Blast Phase	Blast phase chronic myelogenous leukemia	BEFREE	19237556		★☆☆☆☆ Found in Text Mining only
Blood Platelet Disorders	Platelet disorder	Pubtator	35285386	Associate	★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone disease	Pubtator	31769620	Associate	★☆☆☆☆ Found in Text Mining only
Bone Marrow Diseases	Bone marrow diseases	Pubtator	21508124	Associate	★☆☆☆☆ Found in Text Mining only
Bone Marrow Neoplasms	Bone Marrow Neoplasms	BEFREE	12135667		★☆☆☆☆ Found in Text Mining only
Bone Marrow Neoplasms	Bone neoplasm	Pubtator	12135667	Associate	★☆☆☆☆ Found in Text Mining only
Bowen`s Disease	Bowen`s Disease	CTD_human_DG	29103775		★☆☆☆☆ Found in Text Mining only
Brain Diseases	Brain disease	Pubtator	26908328	Associate	★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	15981100, 24870765, 30972946, 31846072, 8621248		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Brain Neoplasms	Brain Neoplasms	CTD_human_DG	20932960, 27935819		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Brain Neoplasms	Brain neoplasms	Pubtator	23991960, 24610618, 25120774, 31287555, 32373934	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Brain Tumor, Primary	Brain Neoplasms	CTD_human_DG	20932960, 27935819		★☆☆☆☆ Found in Text Mining only
Brain Tumor, Primary	Brain Neoplasms	BEFREE	23991960		★☆☆☆☆ Found in Text Mining only
Breast Cancer, Familial	Breast Cancer	BEFREE	21327470		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	10066068, 10070974, 10208420, 10393358, 10398079, 10887489, 11007034, 11012095, 11110058, 11150915, 11156526, 11248121, 11263590, 11432833, 11525606, 11836618, 11848520, 11870541, 11948404, 11956082, 11994274, 12096344, 12429977, 12448002, 12738746, 12755491, 12839951, 12955092, 14522919, 14703063, 14712077, 14871808, 14979917, 15082921, 15138475, 15178330, 15322430, 1532244, 15576832, 15578074, 15585484, 15585645, 15648612, 1565470, 15668481, 1568216, 15796211, 15845652, 15961768, 15996662, 16061635, 16155412, 16260626, 16273236, 16331604, 16413464, 16413469, 16446704, 16465433, 16473739, 16504004, 16510571, 16648863, 16829689, 16849553, 16860316, 16980581, 17066426, 17088977, 17116943, 17255770, 17278098, 17334399, 17387344, 17486065, 17653856, 17668048, 17909257, 18043898, 18067636, 18194538, 18237245, 18240019, 18330478, 18341653, 18393977, 18592373, 18819000, 19119452, 19142864, 19287456, 19636701, 19779113, 19787783, 19855437, 19878873, 19915977, 19941161, 19967453, 20008985, 20038817, 20404095, 20406885, 20421209, 20429623, 20525379, 20530440, 20683061, 2071147, 21044962, 21159451, 21161398, 21327470, 21350001, 21399894, 21401699, 21447726, 21497294, 21503589, 21521417, 21675838, 2181375, 21955753, 22002566, 22037875, 22231956, 22318732, 22465097, 22475046, 22538871, 22791882, 22812184, 22863309, 22976805, 23244103, 23336272, 23390492, 23516601, 23568005, 23613410, 23636126, 23670132, 23688195, 23786849, 23839043, 23861098, 23938323, 24190141, 24287487, 24330704, 24345432, 24552806, 24606123, 24607787, 24621502, 24785256, 24862872, 25363551, 25399071, 25657113, 25879784, 25940700, 26397146, 26409837, 26416047, 26431674, 26621531, 27208794, 27596272, 27668537, 28004353, 28123641, 28528450, 28533512, 28551632, 28893536, 29135104, 29137223, 29140993, 29177689, 29236940, 29246317, 29416786, 29511965, 29693804, 29721077, 30361291, 30463098, 30742303, 30816904, 30819233, 31015230, 31023256, 31112577, 31169265, 31243265, 31243808, 31263160, 31426542, 31534541, 7546834, 7621424, 7675778, 7720042, 7898937, 7942638, 7961120, 8137296, 8168995, 8195927, 8208295, 8208539, 8336939, 8426754, 8474448, 8649362, 8797766, 8867812, 9001420, 9065811, 9121767, 9133450, 9274525, 9380415, 9500441, 9591636, 9665480, 9747885, 9769125, 9815758, 9816251, 9816285, 9824849, 9831206		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Carcinoma	Breast Carcinoma	CTD_human_DG	12839951, 17255770, 19636701, 20948315, 23839043, 25267515		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Carcinoma	Breast Carcinoma	GWASCAT_DG	29059683		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	10050790, 10393358, 10474686, 10480344, 10500157, 10604729, 10759547, 10934345, 11160886, 11304576, 11311237, 11410592, 11449404, 11477142, 11870541, 11875707, 11994274, 12032322, 12364325, 12379472, 12379776, 12480939, 15138475, 15178330, 15796211, 15808510, 15845652, 15861516, 15996662, 16166625, 16341149, 16446704, 16504004, 16648863, 16672066, 16823179, 16980581, 17344214, 17407600, 17427198, 17517369, 17668048, 17670745, 17998543, 18327210, 18632615, 18823530, 18838752, 19035289, 19119452, 19242061, 19287456, 19470724, 19477949, 19706770, 19779113, 19825990, 19865540, 19966541, 20062009, 20139903, 20179208, 20421209, 20473280, 20736297, 20802156, 20971731, 21044962, 21203424, 21497294, 21503589, 21505052, 21737572, 21955753, 21989330, 22231956, 22318732, 22362714, 22475046, 22548824, 22686279, 22860097, 22863309, 22918167, 22919439, 22929921, 23244103, 23321641, 23336272, 23368093, 23390492, 23540573, 23554130, 23565238, 23568005, 23613410, 23741361, 23839043, 24272202, 24367492, 24371368, 24559156, 24568493, 24621502, 24848372, 24896091, 24911119, 25006666, 25014225, 25124606, 25313758, 25846733, 25879784, 25927147, 25966904, 26008969, 26047605, 26617750, 26621531, 27028851, 27208794, 27307030, 27388253, 27596272, 27831653, 27852271, 28066056, 28138513, 28370734, 28415819, 28719033, 28794284, 28797035, 29140993, 29236940, 29344652, 29511965, 29512753, 29562954, 29693804, 29843638, 30119151, 30268765, 30420728, 30776175, 30819233, 30848493, 31023256, 31078043, 31112577, 31467112, 31484966, 31603118, 31629678, 31656498, 31684907, 31801599, 32091409, 32377705, 32652519, 32879494, 32885893, 33001984, 33046520, 33082214, 33139730, 33350292, 33438725, 33461524, 33927198, 34076995, 34099764, 34193109, 34227093, 34394279, 34452574, 34707101, 35186236, 35254385, 35383130, 35459982, 36308067, 36915230, 37068562, 37116133, 37145128, 37198482, 39273534, 40595045, 8058751, 8497271, 8611372, 8622677, 8649362, 8905027, 9033283, 9177226, 9199341, 9218727, 9271411, 9388270, 9528753, 9665480	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	15578074, 17384216, 23750285, 28528450, 37574724	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	20406885, 23914993	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms Male	Male breast neoplasms	Pubtator	20152033, 22527098, 22918167, 27765917	Associate	★☆☆☆☆ Found in Text Mining only
Bronchioloalveolar Adenocarcinoma	Lung adenocarcinoma	BEFREE	10231419		★☆☆☆☆ Found in Text Mining only
Bulimia Nervosa	Bulimia	BEFREE	21093928		★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt lymphoma	Pubtator	26873538	Associate	★☆☆☆☆ Found in Text Mining only
Cancer of Nasopharynx	Nasopharyngeal Cancer	BEFREE	25516222		★☆☆☆☆ Found in Text Mining only
Cancer of Urinary Tract	Urinary Tract Cancer	CTD_human_DG	21040761		★☆☆☆☆ Found in Text Mining only
Capillary hemangioma of retina	Capillary Hemangioma Of Retina	HPO_DG			★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	10749591, 11079730, 11106243, 11544278, 11900573, 12181248, 12917336, 14566053, 1483873, 15810077, 16012517, 16163549, 16740029, 17549669, 19074853, 19237565, 19430707, 19779113, 19917254, 20174823, 20179208, 20306448, 20704822, 21042715, 22266466, 22336657, 23094073, 23396251, 23803020, 23947899, 24499623, 24774443, 25120782, 25511212, 25809706, 26323637, 27402308, 28600574, 28952212, 30229897, 31023256, 31982864, 32102509, 33784509, 35389764, 35844799, 36631756, 36849369, 7747810, 7972105, 8142653, 8562333, 9310139, 9738978	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	36359790	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoid Tumor	Carcinoid tumor	Pubtator	11231488, 15154011, 26008974	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	10066068, 10371338, 10474686, 10526265, 10534337, 10680670, 10782880, 11288983, 11352854, 11406552, 11751405, 11836618, 11920603, 12081197, 12454817, 12507294, 12649172, 12771029, 12955092, 14697637, 15322430, 15378768, 15557752, 15578423, 15606674, 15896460, 16051426, 16413469, 17139501, 17587243, 17600882, 17641416, 17724472, 18484097, 19084934, 19276161, 2011398, 20334896, 20373052, 20540739, 2181375, 22406359, 23400686, 23453270, 23494454, 23824821, 24403468, 24510244, 24809775, 27105504, 27447534, 27956520, 30321764, 7607576, 7675778, 7705920, 7866635, 8062283, 8250909, 8302597, 8415648, 8599583, 8625145, 8626826, 8729983, 8832554, 9042789, 9155044, 9333020, 9591537, 9615803, 9669669, 9669801, 9816282, 9840520		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinoma	Carcinoma	CTD_human_DG	12376462, 14522882, 16316942, 17173897		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinoma	Carcinoma	Pubtator	26847678, 32487254, 34312479	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinoma Basal Cell	Basal cell carcinoma	Pubtator	12707032, 19448414, 30754660, 32319607	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal	Ductal carcinoma	Pubtator	22052326, 25313758, 26884359, 28618949, 31656498, 35743985	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal Breast	Ductal carcinoma of breast	Pubtator	20530440, 25313758, 9212742	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Embryonal	Embryonal carcinoma	Pubtator	10419526	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Endometrioid	Endometrioid carcinoma	Pubtator	11900573, 23947899	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Endometrioid	Endometrioid carcinoma	Pubtator	15330159, 29969496, 39940659	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	11511787, 12692418, 15991281, 17275129, 17278226, 19140237, 20714998, 21625435, 22942717, 24083596, 24570185, 25120782, 25173640, 25822088, 25851350, 25985117, 26002580, 26823834, 27468214, 27697092, 27765911, 28182015, 28378640, 28591705, 28742201, 28844099, 29191172, 29298665, 29895195, 29976634, 30903681, 30930425, 31340767, 31827061, 31969493, 32146796, 32236628, 32418739, 32443384, 32462022, 33902004, 33960941, 34732665, 34897107, 35290436, 35628212, 35694386, 35720901, 35874743, 35941537, 35958019, 36069218, 36432116, 36588796, 37928273, 38019243, 38393314, 39447710	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	27465549	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	34959221	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma in situ of uterine cervix	Cervical Intraepithelial Neoplasia	BEFREE	19475528		★☆☆☆☆ Found in Text Mining only
Carcinoma Intraductal Noninfiltrating	Intraductal noninfiltrating carcinoma	Pubtator	10957889, 14612904, 18941930, 26884359, 9212742	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Intraductal Noninfiltrating	Intraductal noninfiltrating carcinoma	Pubtator	16341149	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Large Cell	Large cell carcinoma	Pubtator	15154011	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Lobular	Lobular carcinoma	Pubtator	27078887, 28095868, 31229512, 35477749, 35743985	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Lobular	Lobular carcinoma	Pubtator	9033283	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Merkel Cell	Merkel cell carcinoma	Pubtator	31694959	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	10473073, 11872630, 12237776, 12372886, 12896908, 14648664, 15245939, 15390184, 15590562, 18361427, 20380574, 20575692, 21766505, 21789902, 23887292, 23893383, 24264314, 24324055, 25556372, 25888950, 28109084, 30104251, 30387807, 30446453, 31164795, 8622895, 9815621		★☆☆☆☆ Found in Text Mining only
Carcinoma of larynx	Laryngeal carcinoma	BEFREE	16258756, 17201183, 19139013, 21193919, 25516222, 27220728, 9816104, 9840520		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	10101007, 10190311, 10231419, 10964085, 12775733, 12807740, 12867074, 16406195, 16912209, 17011980, 17145885, 17908995, 17922974, 19047108, 19052819, 19289374, 21636543, 2170896, 21847632, 21965784, 22387541, 22528945, 22534667, 22752428, 22901215, 23184915, 23237220, 23276293, 23563092, 23653001, 23776433, 23857284, 23867991, 23873109, 24774443, 24894675, 25754817, 26512878, 26681199, 28824300, 29565490, 29739297, 30086699, 30268477, 30317923, 30553472, 30669360, 31399647, 31638210, 31838249, 9192978		★☆☆☆☆ Found in Text Mining only
Carcinoma of Male Breast	Breast Carcinoma, male	BEFREE	15300811, 22527098, 27765917		★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	25889927, 27831653, 30846486, 32901852	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	19851352, 20113529, 26530532, 35448172	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	10471053, 11720477, 12778072, 19401348, 19473483, 22406644, 23094073, 23951092, 23981302, 24777966, 25227113, 27766950, 28281968, 30032137, 30941985, 31183974, 31259714, 31434797, 31599407, 31850854, 32444962, 35266008, 35676472, 36741922, 36901940, 37744271, 40186141	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	23947899	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	32013938	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma Small Cell	Small cell carcinoma	Pubtator	11986399, 15154011	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	11737469, 12707032, 15743689, 16832409, 17695500, 20103831, 20631638, 21537090, 22835384, 26030731, 26055143, 26479420, 26943773, 27145277, 27488595, 27498289, 27877079, 28052061, 31567982, 32685473, 33219256, 33833226, 34738627, 34851968, 37930255, 39928484	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	14966901, 8711937	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Transitional Cell	Transitional cell carcinoma	Pubtator	11161387, 12237776, 9192983	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Basal Cell	Carcinoma	BEFREE	10975609, 11392875, 15723720, 28329421		★☆☆☆☆ Found in Text Mining only
Carcinoma, Cribriform	Carcinoma	CTD_human_DG	26432044		★☆☆☆☆ Found in Text Mining only
Carcinoma, Granular Cell	Carcinoma	CTD_human_DG	26432044		★☆☆☆☆ Found in Text Mining only
Carcinoma, Neuroendocrine	Carcinoma	BEFREE	26434631		★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	10329035, 10584879, 11395387, 15297421, 15505422, 15545188, 23907459, 24858206, 28521400, 28598010, 30205383, 30409964, 30414739, 8607831, 9038263, 9790790		★☆☆☆☆ Found in Text Mining only
Carcinoma, Spindle-Cell	Carcinoma	CTD_human_DG	12376462, 14522882, 16316942, 17173897		★☆☆☆☆ Found in Text Mining only
Carcinosarcoma	Carcinosarcoma	BEFREE	11231499		★☆☆☆☆ Found in Text Mining only
Carcinosarcoma	Carcinoma	Pubtator	11231499	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomegaly	Cardiomegaly	Pubtator	36046382	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Dilated	Dilated cardiomyopathy	Pubtator	31705051	Inhibit	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Dilated	Dilated cardiomyopathy	Pubtator	37372424	Stimulate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	BEFREE	22011761, 22052326, 23031786, 24888777		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	9430399		★☆☆☆☆ Found in Text Mining only
Cataract congenital with microcornea or slight microphthalmia	Cataract-microcornea syndrome	Pubtator	23811327	Stimulate	★☆☆☆☆ Found in Text Mining only
Cecal Neoplasms	Cecal neoplasm	CTD_human_DG	14688030		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Celiac Disease	Celiac disease	Pubtator	35208504	Associate	★☆☆☆☆ Found in Text Mining only
Cerebellar hemangioblastoma	Cerebellar hemangioblastoma	HPO_DG			★☆☆☆☆ Found in Text Mining only
Cerebrovascular Disorders	Cerebrovascular Disorders	BEFREE	9430399		★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	11371120, 14666699, 15221962, 15896460, 15949570, 16865248, 18548202, 19489683, 19585495, 20473525, 20680537, 21594903, 23111469, 24737585, 25204741, 26631043, 27364926, 27732565, 28521400, 29416780, 30198868, 30361291, 30903019, 31695498		★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	CTD_human_DG	26432044		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	11311493, 11371120, 15221962, 15896460, 15949570, 16865248, 18548202, 19489683, 19585495, 20473525, 20680537, 21594903, 23111469, 24737585, 25204741, 26631043, 27364926, 27732565, 28521400, 29416780, 30198868, 30361291, 30903019, 31695498		★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	10216470, 12537975, 16207592, 16522546, 18096764, 23613410, 25037230, 26617896		★☆☆☆☆ Found in Text Mining only
Childhood Hepatocellular Carcinoma	Liver carcinoma	BEFREE	17546056		★☆☆☆☆ Found in Text Mining only
Childhood Malignant Peripheral Nerve Sheath Tumor	Malignant Peripheral Nerve Sheath Tumor	BEFREE	29332262, 30883338		★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	19147556, 22682621, 27966820, 28856557, 28915627		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	12125919, 15696189, 17294242, 22972485, 24549785, 30444036, 35307646, 35792239, 37576707	Associate	★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	LHGDN	16142313, 18618300		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	16767220, 17587243, 23799613		★☆☆☆☆ Found in Text Mining only
Cholelithiasis	Cholecystolithiasis	Pubtator	23803020	Associate	★☆☆☆☆ Found in Text Mining only
Cholesteatoma	Cholesteatoma	Pubtator	18347258, 24311896	Associate	★☆☆☆☆ Found in Text Mining only
Cholesteatoma Middle Ear	Middle ear cholesteatoma	Pubtator	24311896	Associate	★☆☆☆☆ Found in Text Mining only
Chondromyxoid fibroma	Chondromyxoid Fibroma	BEFREE	17559135		★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	BEFREE	11859213, 18624751		★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	Pubtator	17559135	Inhibit	★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	Pubtator	18624751, 19734846	Associate	★☆☆☆☆ Found in Text Mining only
Chordoma	Chordoma	Pubtator	16078265	Associate	★☆☆☆☆ Found in Text Mining only
Chromophobe Renal Cell Carcinoma	Chromophobe Carcinoma	BEFREE	16337860, 19386349		★☆☆☆☆ Found in Text Mining only
Chronic Disease	Chronic disease	Pubtator	34220309	Stimulate	★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	10482984, 10557044, 10561025, 10980628, 12040434, 12127555, 1375109, 15289859, 16334487, 17251335, 1757070, 1900388, 19704260, 2070085, 2078513, 20884628, 21272268, 21479697, 2242428, 24190490, 26261659, 27407063, 2787901, 28408436, 29115462, 29254788, 3259659, 7918073, 7919385, 8049438, 8102560, 8172823, 8203469, 8499640, 8623758, 9057657, 9067285, 9250825, 9291459, 9324302, 9556424, 9626342, 9739021		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	ORPHANET_DG			★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	25708588, 28214201, 31593832		★☆☆☆☆ Found in Text Mining only
Ciliopathies	Ciliopathies	BEFREE	29342244		★☆☆☆☆ Found in Text Mining only
Clear cell sarcoma of kidney	Sarcoma Of Kidney	BEFREE	22256788, 25751590, 28833375, 30736802		★☆☆☆☆ Found in Text Mining only
Clear-cell metastatic renal cell carcinoma	Renal Carcinoma	BEFREE	11920465, 24777966, 30941985		★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	Pubtator	20306448	Associate	★☆☆☆☆ Found in Text Mining only
Colitis	Colitis	BEFREE	28145888		★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	20306448, 37960728	Associate	★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	36658474	Inhibit	★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	10201372, 11507050, 15004225, 19084934, 19232344, 19415698, 19440933, 19549773, 19572978, 20332435, 20950152, 22884800, 22886548, 23464457, 23567490, 25229241, 27105504, 27191497, 28492347, 28684297, 30091007, 30462152		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	BEFREE	10514384, 21569306		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colonic Neoplasms	Colonic neoplasm	Pubtator	10749591, 11696421, 19084934, 19542220, 20841488, 32727450, 34414457	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colonic Neoplasms	Colonic neoplasm	Pubtator	16012517	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colonic Neoplasms	Colonic Neoplasms	CTD_human_DG	18283038, 19147571, 21081470, 21188121		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Carcinoma	Colorectal Cancer	BEFREE	10964085, 11896626, 12081197, 12196377, 14657069, 14666635, 15557752, 15908664, 15993030, 16328437, 16495921, 16552496, 16788380, 16829689, 17264243, 17960397, 18027856, 18196581, 18806828, 18983468, 19107235, 19412426, 19499154, 19795398, 20306448, 20683026, 21102582, 21107342, 21517236, 21544737, 22050898, 22117530, 22322158, 22606291, 23337059, 23354584, 23376423, 23576566, 24240588, 24885829, 25146682, 25809706, 26239303, 26316447, 27191497, 27492458, 27755946, 28000901, 28009989, 28978149, 29049220, 29338680, 29527286, 29552187, 29771440, 29901203, 30064475, 30158634, 30323621, 30662799, 30731403, 31196027, 31306481, 9298583		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	GENOMICS_ENGLAND_DG			★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	10318916, 11106567, 12196377, 15004225, 15090460, 15188006, 15385053, 15557752, 16328068, 16495921, 16829689, 16882699, 18822177, 18983468, 19064714, 19499154, 19542220, 19549253, 19549773, 19690970, 20141613, 20306448, 21102582, 21107342, 22050898, 22117530, 22773039, 22814742, 22886548, 22919439, 23194063, 23558963, 24098334, 24240588, 24256736, 24504536, 24885829, 25146682, 25229241, 25352148, 25386076, 25469035, 25745771, 25809706, 25818893, 26121043, 27080994, 27492458, 27595705, 28035994, 28081740, 28345468, 28416735, 28440426, 28675510, 28870200, 28968471, 29286138, 29512788, 29554905, 29749530, 29771440, 29794421, 30064475, 30091007, 30224477, 30658502, 30942397, 31040202, 31191746, 31450922, 31648230, 31718693, 31949199, 32016467, 32102509, 32132307, 32373955, 33029691, 33733923, 33878735, 34077003, 34414457, 34931923, 35468741, 35763638, 36037145, 36230970, 36303457, 36672275, 36734282, 37248886, 37475862, 37950153, 38064496, 39739897, 39768127, 39940699, 8576279	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	10749591, 15162527	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	14657069, 14666635, 14679024, 15557752, 16328437, 16552496, 16829689, 17960397, 18983468		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Neoplasms	Colorectal Neoplasms	BEFREE	14679024, 15557752, 8649851		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Neoplasms Hereditary Nonpolyposis	Lynch syndrome	Pubtator	16495921, 19690970, 32102509	Associate	★☆☆☆☆ Found in Text Mining only
Comedone	Comedone	BEFREE	11836618		★☆☆☆☆ Found in Text Mining only
Compression of spinal cord	Spinal cord compression	HPO_DG			★☆☆☆☆ Found in Text Mining only
Congenital chromosomal disease	Congenital Chromosomal Disease	BEFREE	11552984, 12127561, 14697637, 16715125, 18842998, 19813013, 21334716, 21677543, 22076037, 30389156, 31776787, 7950478, 9380412, 9665480, 9669839		★☆☆☆☆ Found in Text Mining only
Congenital contractural arachnodactyly	Congenital Contractural Arachnodactyly	BEFREE	29221199, 31199052		★☆☆☆☆ Found in Text Mining only
Congenital hypoplasia of lung	Pulmonary hypoplasia	BEFREE	22110187		★☆☆☆☆ Found in Text Mining only
Congenital Mesoblastic Nephroma	Congenital Mesoblastic Nephroma	BEFREE	27020209		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	12796377, 15538282, 16954163, 19246164, 19401348, 21693435, 22155254, 23951092, 25669170, 27766950, 29253611, 30459299, 30941985, 31183974, 31434797, 31748879, 31832810		★☆☆☆☆ Found in Text Mining only
Corneal Dystrophy Posterior Polymorphous 1	Posterior polymorphous corneal dystrophy	Pubtator	28654985	Associate	★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	11336400, 25124382, 8565160		★☆☆☆☆ Found in Text Mining only
Craniopharyngioma	Craniopharyngioma	Pubtator	35707464	Associate	★☆☆☆☆ Found in Text Mining only
Craniosynostosis	Craniosynostosis	BEFREE	24943192		★☆☆☆☆ Found in Text Mining only
CREST Syndrome	CREST Syndrome	BEFREE	20373052		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	20306448		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	20306448	Associate	★☆☆☆☆ Found in Text Mining only
Cutaneous Melanoma	Melanoma	BEFREE	12036934, 15703813, 16523260, 21300445, 23001925		★☆☆☆☆ Found in Text Mining only
Cutaneous Melanoma	Melanoma	CGI_DG			★☆☆☆☆ Found in Text Mining only
Cyclic neutropenia	Cyclic Neutropenia	BEFREE	21801719		★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	28548679, 28647646, 30119190, 31155960, 31572500		★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	22760121, 25358426		★☆☆☆☆ Found in Text Mining only
Dermatitis Atopic 1	Atopic dermatitis	Pubtator	20426528	Associate	★☆☆☆☆ Found in Text Mining only
Dermatofibrosarcoma Protuberans	Dermatofibrosarcoma Protuberans	BEFREE	29792909		★☆☆☆☆ Found in Text Mining only
Desmoid disease hereditary	Desmoid tumor	Pubtator	11796830, 17090192	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	30462152		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	30462152		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus	Diabetes mellitus	Pubtator	33490239	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	10504475, 36303457	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	29620215, 32851081	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Foot	Diabetic foot	Pubtator	23194110, 37985432, 38107519	Associate	★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	10803523, 11697627, 14767533, 15131039, 18343791, 20062012, 2078513, 21281227, 21334716, 21479697, 24648050, 24722063, 25596256, 26034867, 26985765, 28032914, 28296741, 30211726, 31688139, 3259659, 7541611		★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down Syndrome	BEFREE	24806449, 26137553		★☆☆☆☆ Found in Text Mining only
Ductal Breast Carcinoma	Breast Carcinoma	BEFREE	25313758, 25470788		★☆☆☆☆ Found in Text Mining only
Ductal Carcinoma	Ductal Carcinoma	BEFREE	11836618, 25313758, 8195927, 8832554, 9831206		★☆☆☆☆ Found in Text Mining only
Dwarfism	Dwarfism	BEFREE	23624920		★☆☆☆☆ Found in Text Mining only
Dyskinesias	Dyskinesia	Pubtator	19623652, 21990607	Associate	★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	BEFREE	25944971		★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	Pubtator	25944971	Associate	★☆☆☆☆ Found in Text Mining only
Dysplastic Nevus	Dysplastic Nevus	BEFREE	11175636, 17525627, 20496072		★☆☆☆☆ Found in Text Mining only
ECTRODACTYLY, ECTODERMAL DYSPLASIA, AND CLEFT LIP/PALATE SYNDROME 1	Ectrodactyly	BEFREE	12955092, 23731275, 25214561, 27711077, 30702464		★☆☆☆☆ Found in Text Mining only
Endocrine System Diseases	Endocrine system disease	Pubtator	29443735	Associate	★☆☆☆☆ Found in Text Mining only
Endometrial adenocarcinoma	Endometrial Adenocarcinoma	BEFREE	15474160, 30705597		★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	10901378, 11957146, 12955092, 14648178, 15069681, 15863141, 16293976, 18822177, 22459351, 23733133, 27105504, 28965628, 29232554, 29393479, 30585737, 30705597, 31001342, 8826947		★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	CTD_human_DG	29232554		★☆☆☆☆ Found in Text Mining only
Endometrial Hyperplasia	Endometrial hyperplasia	Pubtator	23947899	Stimulate	★☆☆☆☆ Found in Text Mining only
Endometrial Hyperplasia	Endometrial hyperplasia	Pubtator	39940659	Associate	★☆☆☆☆ Found in Text Mining only
Endometrial Hyperplasia	Endometrial Hyperplasia	BEFREE	8826947		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	10901378, 11900573, 15111320, 15330159, 16884382, 18822177, 23947899, 25214561, 26218748, 27831653, 29969496, 39940659, 40090626	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Endometrial Neoplasms	Endometrial Neoplasms	LHGDN	14666673, 15863141, 16884382, 18822177		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	25511212	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Endometrial Neoplasms	Endometrial Neoplasms	CTD_human_DG	29232554		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Endometrial Stromal Sarcoma	Endometrial Stromal Sarcoma	BEFREE	19898427, 22982899, 24186140, 25751590		★☆☆☆☆ Found in Text Mining only
Endometrial stromal sarcoma, high grade	Endometrial Stromal Sarcoma	BEFREE	19898427		★☆☆☆☆ Found in Text Mining only
Endometrioid carcinoma ovary	Ovarian endometrioid carcinoma	BEFREE	24018808		★☆☆☆☆ Found in Text Mining only
Endometrioma	Endometrioma	BEFREE	28720098		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	LHGDN	16616093		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	19074548, 19589865, 22884659, 28720098	Associate	★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	19589865, 22884659		★☆☆☆☆ Found in Text Mining only
Eosinophilic esophagitis	Eosinophilia	BEFREE	25164712		★☆☆☆☆ Found in Text Mining only
Ependymoma	Ependymoma	BEFREE	29416789, 31308481		★☆☆☆☆ Found in Text Mining only
Epidermolysis bullosa simplex Ogna type	Epidermolysis bullosa	Pubtator	28675510	Associate	★☆☆☆☆ Found in Text Mining only
Epilepsy Partial with Variable Foci	Progressive myoclonic epilepsy	Pubtator	23439433	Associate	★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	10584879, 15297421, 28598010		★☆☆☆☆ Found in Text Mining only
Epithelioid and spindle cell nevus	Spitz nevus	BEFREE	22882594		★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	10419705, 12014632, 12739008, 14606066, 14966901, 16051426, 16490596, 16732330, 17561354, 21785828, 21869822, 22150974, 22919244, 22996377, 23020291, 23661400, 24206575, 24810640, 26561473, 27906434, 28325828, 29673440, 31444279, 7630641, 7747810, 7866635, 8415648, 9458316		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	11315260, 14606066, 14966901, 15991276, 16163549, 17309796, 19136271, 19448414, 20389301, 22919244, 22938416, 22996377, 24024333, 26561473, 26717044, 27145270, 27831653, 27893424, 27906434, 31171890, 31450922, 32580137, 32728182, 33529461, 35242498, 35879265, 35937565, 7747810, 7972105, 8415648	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	12014632, 12739008, 14606066, 14966901, 16051426, 16490596, 16732330, 17561354, 21869822, 22150974, 22919244, 22996377, 23020291, 23661400, 24206575, 24810640, 26561473, 28325828, 29673440, 31444279, 7630641, 7747810, 8415648, 9458316		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Esophageal Neoplasms	Esophagus Neoplasm	CTD_human_DG	12235107		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Esophageal Neoplasms	Esophagus Neoplasm	LHGDN	16273238, 16732330, 17561354, 17912028		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	24022664	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	10390005, 11315260, 11570573, 15484291, 16827140, 17309796, 18084253, 18405350, 19448414, 20389301, 21734802, 22477709, 22761904, 24024333, 25160749, 25438156, 25550842, 26386145, 26873401, 27145270, 27721245, 27893424, 28602785, 29845226, 29866946, 30551519, 31851786, 32252688, 32580137, 32908901, 33725708, 33784509, 33789967, 35242498, 9459151, 9497916	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Esophagitis	Esotropia	Pubtator	11315260, 11544278, 14606066	Associate	★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	Pubtator	23892638	Associate	★☆☆☆☆ Found in Text Mining only
Ewings sarcoma	Ewing sarcoma	BEFREE	14977835, 15342383, 18677114, 25015333, 26337082, 26363896, 27984122, 30131386, 30736802, 31072811		★☆☆☆☆ Found in Text Mining only
Ewings sarcoma-primitive neuroectodermal tumor (PNET)	Ewing sarcoma	BEFREE	26363896, 27984122, 9393981		★☆☆☆☆ Found in Text Mining only
Familial Alzheimer Disease (FAD)	Alzheimer disease	BEFREE	18239458, 18466334		★☆☆☆☆ Found in Text Mining only
Familial aplasia of the vermis	Cerebellar vermis agenesis	BEFREE	18054307		★☆☆☆☆ Found in Text Mining only
Familial cylindromatosis	Familial cylindromatosis	Pubtator	22832488	Inhibit	★☆☆☆☆ Found in Text Mining only
Familial Isolated Hyperparathyroidism	Hyperparathyroidism	BEFREE	15580289		★☆☆☆☆ Found in Text Mining only
Familial lichen amyloidosis	Lichen amyloidosis	BEFREE	21289624		★☆☆☆☆ Found in Text Mining only
Familial multiple trichoepitheliomata	Multiple Trichoepithelioma	BEFREE	15297940, 16399423, 17308274, 25888009		★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	12917338, 31034519		★☆☆☆☆ Found in Text Mining only
Fibroadenoma	Fibroadenoma	BEFREE	15648612		★☆☆☆☆ Found in Text Mining only
Fibroid Tumor	Leiomyoma	LHGDN	12634633, 18182398		★☆☆☆☆ Found in Text Mining only
Fibroid Tumor	Leiomyoma	BEFREE	24130091		★☆☆☆☆ Found in Text Mining only
Fibrolamellar Hepatocellular Carcinoma	Hepatocellular Carcinoma	BEFREE	22292081		★☆☆☆☆ Found in Text Mining only
Fibromatosis, Aggressive	Fibromatosis	BEFREE	11796830		★☆☆☆☆ Found in Text Mining only
Fibromatosis, Aggressive	Fibromatosis	LHGDN	17090192		★☆☆☆☆ Found in Text Mining only
Fibromyxosarcoma	Fibromyxosarcoma	BEFREE	18807072		★☆☆☆☆ Found in Text Mining only
Fibrosarcoma	Fibrosarcoma	BEFREE	8302597, 8797766, 8852336, 9218727		★☆☆☆☆ Found in Text Mining only
Gallbladder Carcinoma	Gallbladder cancer	BEFREE	17617380		★☆☆☆☆ Found in Text Mining only
Gallbladder Neoplasms	Gallbladder neoplasm	Pubtator	11106243, 15655836, 23803020	Associate	★☆☆☆☆ Found in Text Mining only
Ganglioneuroblastoma	Ganglioneuroblastoma	BEFREE	26510683, 27984122		★☆☆☆☆ Found in Text Mining only
Ganglioneuroma	Ganglioneuroma	BEFREE	18413728, 26510683		★☆☆☆☆ Found in Text Mining only
Gastric Adenocarcinoma	Gastric Cancer	BEFREE	12606305		★☆☆☆☆ Found in Text Mining only
Gastroesophageal Reflux	Gastroesophageal reflux disease	Pubtator	15971196	Associate	★☆☆☆☆ Found in Text Mining only
Gastroesophageal reflux disease	Gastroesophageal Reflux Disease	BEFREE	15971196		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Neoplasms	Gastrointestinal neoplasm	Pubtator	11311237, 16163549, 36681091	Associate	★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	BEFREE	15864317, 31371779		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	Pubtator	15864317, 25987131	Associate	★☆☆☆☆ Found in Text Mining only
Germ cell tumor	Tumor	BEFREE	20395447		★☆☆☆☆ Found in Text Mining only
Giant Cell Arteritis	Giant Cell Arteritis	BEFREE	21275459		★☆☆☆☆ Found in Text Mining only
Giant Cell Fibroblastoma	Giant Cell Fibroblastoma	BEFREE	29792909		★☆☆☆☆ Found in Text Mining only
Giant Cell Tumor of Bone	Giant cell tumor of bone	Pubtator	16479604, 32866294	Associate	★☆☆☆☆ Found in Text Mining only
Giant Cell Tumor of Bone	Giant cell tumor of bone	BEFREE	19324500, 31233932		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	10419598, 15517868, 15557280, 17509221, 1827756, 21455311, 21912938, 23806108, 25764520, 26681767, 26700671, 27226604, 27466513, 28628119, 28952134, 29218546, 30562739, 30834619, 30957234		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	15517868, 23806108, 26681767, 26700671, 30562739, 33184448, 33801093, 33942556, 34072831, 35287551, 37061119	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	LHGDN	15557280, 17509221		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	15557280, 17509221, 1827756, 21455311, 21912938, 23331016, 23806108, 24967941, 25764520, 26654598, 26681767, 26700671, 27226604, 27466513, 28628119, 28952134, 29218546, 30562739, 30834619, 30957234		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	10416984, 17684142, 20361361, 22304571, 23383003, 24840634, 24995320, 25998224, 28380465, 28643150, 28858735, 29351283, 30101705, 30233244, 30498093, 30972946, 31115554, 31173217, 31661371, 9191053		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	10416984, 15279711, 18404250, 21843312, 22362300, 23991960, 24143218, 24610618, 24995320, 28380465, 28467792, 30562739, 31286678, 33184448, 33660802, 34251962, 34959221, 35365622, 35981653, 37077066, 37845206, 40264162	Associate	★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	LHGDN	12778072		★☆☆☆☆ Found in Text Mining only
Glomerulonephritis IGA	Iga nephropathy	Pubtator	15208647	Associate	★☆☆☆☆ Found in Text Mining only
Growth Disorders	Growth disorder	Pubtator	22905260, 26129688, 26657292	Associate	★☆☆☆☆ Found in Text Mining only
Hairy Cell Leukemia	Hairy Cell Leukemia	BEFREE	10456674, 10471532, 19801969, 19880779, 21479697, 21677543, 7919385, 8547115, 8740788, 9209653, 9291459		★☆☆☆☆ Found in Text Mining only
Hairy Cell Leukemia	Hairy Cell Leukemia	LHGDN	12231535		★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto Disease	BEFREE	15292926		★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto disease	Pubtator	15292926	Associate	★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	10964085, 15368064, 15484403, 18349267, 20443083, 23125009, 23400686, 23730900, 25081680, 25516222, 8004570, 9047388, 9504605, 9736425		★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head And Neck Neoplasms	LHGDN	15375804, 18349267		★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	23125009, 23730900, 37481637	Associate	★☆☆☆☆ Found in Text Mining only
Heart Failure	Heart failure	Pubtator	39351221	Associate	★☆☆☆☆ Found in Text Mining only
Heart Neoplasm	Cardiac Neoplasms	LHGDN	12673692		★☆☆☆☆ Found in Text Mining only
Hemangioblastoma	Hemangioblastoma	BEFREE	16187023		★☆☆☆☆ Found in Text Mining only
Hemangioma	Hemangioma	BEFREE	19823825, 24968760		★☆☆☆☆ Found in Text Mining only
Hemangiosarcoma	Hemangiosarcoma	CTD_human_DG	17569031		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	11260626, 2267133, 30701029, 7531681		★☆☆☆☆ Found in Text Mining only
Hematopoietic Neoplasms	Hematopoietic Neoplasms	BEFREE	10482983, 16479154, 20028861, 2915903, 31261248, 7531681, 8172823		★☆☆☆☆ Found in Text Mining only
Hemimegalencephaly	Hemimegalencephaly	BEFREE	15921235, 16196383, 17483958		★☆☆☆☆ Found in Text Mining only
Hemimegalencephaly	Hemimegalencephaly	Pubtator	16196383	Associate	★☆☆☆☆ Found in Text Mining only
Hemophilia A	Hemophilia a	Pubtator	15094932, 8100097	Associate	★☆☆☆☆ Found in Text Mining only
Hemophilia A	Hemophilia	BEFREE	16129422, 3127923, 7903882		★☆☆☆☆ Found in Text Mining only
Hepatitis Alcoholic	Alcoholic hepatitis	Pubtator	34096637	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis B	Hepatitis b	Pubtator	12461064, 28797035, 29191172, 30819233, 32443384, 7518196, 7919385	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis B	Hepatitis b	Pubtator	35459982	Stimulate	★☆☆☆☆ Found in Text Mining only
Hepatitis B Chronic	Hepatitis b	Pubtator	32443384	Associate	★☆☆☆☆ Found in Text Mining only
Hepatitis C	Hepatitis c	Pubtator	22567048, 7812011	Associate	★☆☆☆☆ Found in Text Mining only
Hepatoblastoma	Hepatoblastoma	BEFREE	11309340, 15133490		★☆☆☆☆ Found in Text Mining only
Hepatoblastoma	Hepatoblastoma	LHGDN	15133490		★☆☆☆☆ Found in Text Mining only
Hepatoblastoma	Hepatoblastoma	Pubtator	32871763	Associate	★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	10050790, 10474686, 12032322, 30394935, 39940659	Associate	★☆☆☆☆ Found in Text Mining only
Hereditary Diffuse Gastric Cancer	Gastric Cancer	CTD_human_DG	21628965		★☆☆☆☆ Found in Text Mining only
Hereditary Leiomyomatosis and Renal Cell Cancer	Hereditary Leiomyomatosis and Renal Cancer	BEFREE	10319380, 10733493, 24178620, 24677400, 26699502, 7612496		★☆☆☆☆ Found in Text Mining only
Hereditary Nonpolyposis Colorectal Cancer	Colorectal Cancer	BEFREE	10667569, 11507050, 16832876, 18027856, 29049220		★☆☆☆☆ Found in Text Mining only
Hereditary pancreatitis	Hereditary Pancreatitis	BEFREE	14981992		★☆☆☆☆ Found in Text Mining only
High Grade Lymphoma (neoplasm)	High Grade Lymphoma	BEFREE	8492222		★☆☆☆☆ Found in Text Mining only
Histiocytosis, Langerhans-Cell	Histiocytosis	BEFREE	28622183		★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	10727987, 11863220, 12411587, 16001955, 1900388, 7531681, 7534138, 8218489, 8619427, 9001420, 9846986		★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	36288644, 9548443	Associate	★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington disease	Pubtator	32109367	Associate	★☆☆☆☆ Found in Text Mining only
Hurthle Cell Tumor	Tumor	BEFREE	15036886, 15036887, 16337860, 19386349		★☆☆☆☆ Found in Text Mining only
Hydatidiform Mole	Hydatidiform mole	Pubtator	28713902	Associate	★☆☆☆☆ Found in Text Mining only
Hypercalcemia	Hypercalcemia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	Pubtator	12379472	Stimulate	★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	12401721		★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Hyperinsulinism	BEFREE	18194492		★☆☆☆☆ Found in Text Mining only
Hyperlipoproteinemia Type I	Hyperlipoproteinemia	BEFREE	8728326		★☆☆☆☆ Found in Text Mining only
Hyperparathyroidism	Hyperparathyroidism	BEFREE	11342573, 12412775, 18398822, 9509445		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperparathyroidism	Hyperparathyroidism	LHGDN	18398822		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperparathyroidism	Hyperparathyroidism	CTD_human_DG	21541686		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperparathyroidism Primary	Hyperparathyroidism	Pubtator	11902820, 27760455	Associate	★☆☆☆☆ Found in Text Mining only
Hyperparathyroidism, Primary	Hyperparathyroidism	BEFREE	11902820, 23660642		★☆☆☆☆ Found in Text Mining only
Hyperparathyroidism, Secondary	Hyperparathyroidism	BEFREE	27071708		★☆☆☆☆ Found in Text Mining only
Hyperplasia	Hyperplasia	Pubtator	11900573	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperplasia	Hyperplasia	Pubtator	16445666, 21505178	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperproteinemia	Hyperproteinemia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Hypersensitivity Immediate	Hypersensitivity	Pubtator	14966904	Associate	★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	30545316	Associate	★☆☆☆☆ Found in Text Mining only
Hypertension Resistant to Conventional Therapy	Resistant hypertension	Pubtator	12778072	Associate	★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	17635070, 30545316		★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	HPO_DG			★☆☆☆☆ Found in Text Mining only
HYPERTRICHOSIS, CONGENITAL GENERALIZED	HYPERTRICHOSIS	BEFREE	17121884		★☆☆☆☆ Found in Text Mining only
Hypertrophy	Hypertrophy	Pubtator	16941028	Stimulate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	15026807, 27793037, 29426911, 32271447	Inhibit	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	18616527, 20831794, 30091007, 32903763	Associate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	22033266, 27656836, 29695901	Stimulate	★☆☆☆☆ Found in Text Mining only
Ichthyosis Bullosa of Siemens	Junctional epidermolysis bullosa	Pubtator	34859100	Associate	★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	31770525		★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	12707032, 18478089, 24551275, 30481203	Associate	★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	16776827, 30095465, 30481203		★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	LHGDN	16776827		★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	16776827	Stimulate	★☆☆☆☆ Found in Text Mining only
IGA Glomerulonephritis	Glomerulonephritis	BEFREE	28237991		★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	10690551, 19855437, 22145922		★☆☆☆☆ Found in Text Mining only
Infertility	Infertility	Pubtator	36303457	Associate	★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	LHGDN	15060836		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	19221492, 20306448		★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	20306448	Associate	★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	23492772	Inhibit	★☆☆☆☆ Found in Text Mining only
Inflammatory Myofibroblastic Tumor	Inflammatory Myofibroblastic Tumor	BEFREE	10908158		★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	30678306	Associate	★☆☆☆☆ Found in Text Mining only
insulinoma	Insulinoma	BEFREE	29225069		★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Intellectual developmental disorder	Pubtator	18616527	Associate	★☆☆☆☆ Found in Text Mining only
Interstitial Cystitis	Interstitial Cystitis	BEFREE	12847144		★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral disc disease	Pubtator	33090383, 33233925, 33764282, 36817437	Associate	★☆☆☆☆ Found in Text Mining only
Intestinal Diseases	Intestinal disease	Pubtator	14645692	Stimulate	★☆☆☆☆ Found in Text Mining only
Intestinal Diseases	Intestinal disease	Pubtator	14966904, 21107342	Associate	★☆☆☆☆ Found in Text Mining only
Intestinal Neoplasms	Intestinal Neoplasms	BEFREE	14688030, 15314168		★☆☆☆☆ Found in Text Mining only
Intestinal Neoplasms	Intestinal neoplasm	Pubtator	20841488	Associate	★☆☆☆☆ Found in Text Mining only
Intraepithelial Neoplasia	Intraepithelial Neoplasia	BEFREE	28365443, 28521400		★☆☆☆☆ Found in Text Mining only
Intrahepatic Cholangiocarcinoma	Intrahepatic Cholangiocarcinoma	BEFREE	11495045, 15619210, 15949570, 16142313, 17587243		★☆☆☆☆ Found in Text Mining only
Invasive Ductal Breast Carcinoma	Invasive Duct and Lobular Carcinoma	BEFREE	10752677, 19145675, 22011761, 23031786, 8832554		★☆☆☆☆ Found in Text Mining only
Jacobsen Distal 11q Deletion Syndrome	Jacobsen Syndrome	BEFREE	18054307		★☆☆☆☆ Found in Text Mining only
Johanson-Blizzard syndrome	Johanson-Blizzard Syndrome	BEFREE	18054307		★☆☆☆☆ Found in Text Mining only
Kaposi Sarcoma	Kaposi Sarcoma	BEFREE	10645225		★☆☆☆☆ Found in Text Mining only
Keratosis	Keratosis	LHGDN	15811121		★☆☆☆☆ Found in Text Mining only
Ki-1+ Anaplastic Large Cell Lymphoma	Anaplastic Lymphoma	BEFREE	19554511		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	10504475	Stimulate	★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	15208647	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	31801948		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	HPO_DG			★☆☆☆☆ Found in Text Mining only
Kidney Failure Chronic	Kidney failure	Pubtator	10201002	Stimulate	★☆☆☆☆ Found in Text Mining only
Kidney Neoplasm	Kidney Neoplasm	CTD_human_DG	21693435		★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	21330408, 22406644, 23981302, 31850854	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Laryngeal neoplasm	Laryngeal neoplasm	LHGDN	19139013		★☆☆☆☆ Found in Text Mining only
Laryngeal Neoplasms	Laryngeal neoplasm	Pubtator	17201183, 17641416, 19139013, 21526487, 23775802, 24470282	Associate	★☆☆☆☆ Found in Text Mining only
Laryngeal Squamous Cell Carcinoma	Laryngeal Carcinoma	BEFREE	10506612, 12112558, 12514403, 15350626, 16258756, 20373052, 21193919, 21315488, 23696923, 25536600, 31427478, 9829720, 9840520		★☆☆☆☆ Found in Text Mining only
Laryngitis	Laryngitis	Pubtator	16832409, 19139013	Associate	★☆☆☆☆ Found in Text Mining only
Leiomyoma	Leiomyoma	Pubtator	29082249, 32417359	Associate	★☆☆☆☆ Found in Text Mining only
Leiomyoma	Leiomyoma	Pubtator	29642801, 31761932, 37231028	Stimulate	★☆☆☆☆ Found in Text Mining only
Leiomyosarcoma	Leiomyosarcoma	Pubtator	18019405	Stimulate	★☆☆☆☆ Found in Text Mining only
Leiomyosarcoma	Leiomyosarcoma	Pubtator	22982899	Associate	★☆☆☆☆ Found in Text Mining only
Lentigo maligna melanoma	Lentigo maligna melanoma	BEFREE	12036934		★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	10557044, 12825853, 1375109, 15086413, 16434317, 19801969, 26125710, 30701029, 8204893, 8499640		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
leukemia	Leukemia	CTD_human_DG	10602166		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Leukemia	Leukemia	Pubtator	19444595, 30229833, 35178295, 39591901, 8204893, 8499640	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Leukemia	Leukemia	Pubtator	9548443	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Leukemia Hairy Cell	Hairy cell leukemia	Pubtator	19801969, 24903677, 25480661, 8740788	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Hairy Cell	Hairy cell leukemia	Pubtator	7919385	Stimulate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid	Myeloid leukemia	Pubtator	11485900	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	16522546, 19874313, 21415215, 27656831, 27843138, 30381403, 32432757, 34431643, 36497125	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Mast-Cell	Leukemia	BEFREE	10319380, 10733493, 24178620, 24677400, 26699502, 7612496		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	15024077, 16522546, 19874313, 19963117, 27843138		★☆☆☆☆ Found in Text Mining only
Leukemia, Myeloid, Accelerated Phase	Myeloid Leukemia	BEFREE	15621754		★☆☆☆☆ Found in Text Mining only
Leukemia, T-Cell	T-cell leukemia	LHGDN	11992406		★☆☆☆☆ Found in Text Mining only
Leukoplakia	Leukoplakia	BEFREE	19634112, 30047791		★☆☆☆☆ Found in Text Mining only
Leukoplakia, Oral	Leukoplakia	BEFREE	19634112, 20662834		★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	10389982, 15791567, 16172916, 16488657, 17893905, 18061526, 19666237, 19679297, 20302655, 21273603, 21506129, 21537090, 22321253, 23111452, 24186074, 24403468, 24675814, 24947332, 25645517, 27653309, 27973759, 29037125		★☆☆☆☆ Found in Text Mining only
liposarcoma	Liposarcoma	BEFREE	21910158		★☆☆☆☆ Found in Text Mining only
Liposarcoma	Liposarcoma	Pubtator	29784880	Associate	★☆☆☆☆ Found in Text Mining only
Liposarcoma, Dedifferentiated	liposarcoma	BEFREE	21910158		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	10385644, 11368878, 11406552, 11408803, 11813305, 11906173, 12375019, 12845670, 12960127, 14687479, 15026472, 15706412, 15991281, 16940298, 17546056, 17587243, 18059167, 18350604, 19009649, 19411833, 19885547, 20332458, 20347627, 20512928, 21327578, 21397858, 21691299, 21878637, 22249261, 22292081, 22429965, 22472110, 22942238, 23221382, 23462179, 23613111, 23740840, 23812424, 24008375, 24083596, 24570185, 25015194, 25109821, 25280563, 25313882, 25851350, 26125710, 26359353, 26361959, 26500057, 26530887, 26882953, 27062697, 27351279, 27448450, 27596272, 27697092, 28182015, 28292020, 28330473, 28368741, 28378640, 28791413, 28885717, 29328502, 29441724, 29895195, 29949741, 29970717, 30201494, 30509085, 30646811, 30698907, 30810974, 30930425, 31168049, 31340767, 31667787, 31747859, 8205525, 8240318, 9302564, 9722210		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	CTD_human_DG	12029619, 19919837, 22649188, 25822088, 26189965		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	LHGDN	12601350, 12692418		★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	Pubtator	34096637, 35338348, 37863651	Associate	★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	19118010, 22472110, 27307407, 27351279		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Liver neoplasms	Liver neoplasms	CTD_human_DG	27064257		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Diseases	Lung disease	Pubtator	19505905	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	CTD_human_DG	11307925, 16289808		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Lung Neoplasms	BEFREE	12579312, 17683579, 9192978		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Lung Neoplasms	LHGDN	12807740, 15809880, 17011980, 17922974, 18715616		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Lung neoplasms	Pubtator	12878869, 15976342, 19074853, 20504322, 22276175, 23237220, 23776433, 24107628, 24695377, 24774443, 24894675, 26121043, 26279304, 27338052, 28231299, 28824300, 29565490, 30669360, 31595832, 32535106, 33148075, 33219256, 33714676, 34074652, 35076182, 8711937, 9192978	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Lung neoplasms	Pubtator	35246017	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Lung neoplasms	Pubtator	37666882	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	10487623, 18925698, 21537090, 22761904, 24324055, 33489719	Stimulate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	15743689, 16265665, 17375037, 18268491, 19119452, 19140237, 20152033, 20543822, 22296356, 22336657, 24470282, 25313758, 25337233, 25536600, 26055143, 27388253, 30459815, 32037399, 32697404, 33714676, 34165442, 34495397, 35459982, 37248886, 37951919, 9459151	Associate	★☆☆☆☆ Found in Text Mining only
Lymphedema	Lymphedema	Pubtator	31450922	Associate	★☆☆☆☆ Found in Text Mining only
Lymphocytosis	Lymphocytosis	BEFREE	11193469, 9067285, 9674745		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	10319386, 10733493, 10803523, 11159766, 11291051, 11697627, 11747333, 11863220, 12036888, 12107101, 12162681, 12231535, 12515730, 12742158, 1394169, 1415486, 14654791, 14961037, 15239399, 15611658, 15692846, 1682919, 1757070, 17934069, 18303407, 19554511, 20062012, 20727381, 2078513, 20960563, 21281227, 21746927, 21790895, 2250191, 22790016, 22791882, 23020673, 25015778, 27776009, 27810071, 28296741, 29109120, 29115462, 7531681, 7591969, 7687458, 7812927, 7961120, 8045522, 8426477, 8426754, 8547655, 8625145, 8852399, 9209653, 9234379, 9376597, 9377576		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	10631455, 11311237, 11747333, 12036888, 15090460, 16522546, 1682919, 17607588, 18483394, 19106104, 20490333, 2070085, 20727381, 21224472, 2207314, 24060591, 29990311, 7579411, 7742549, 8204891, 9548443	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	LHGDN	11935308, 12231535		★☆☆☆☆ Found in Text Mining only
Lymphoma Follicular	Lymphoma	Pubtator	10452515, 12461064, 19321861, 20727381, 33742718, 35622324, 36200794, 8573535, 9763572	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma, Follicular	Lymphoma	BEFREE	10757399, 11245476, 15131039, 17438702, 19321861, 19734488, 19965626, 20231612, 2078513, 24071012, 25953460, 9551917, 9763572		★☆☆☆☆ Found in Text Mining only
Lymphoma, Follicular, Grade 1	Lymphoma	BEFREE	7981893		★☆☆☆☆ Found in Text Mining only
Lymphoma, Large-Cell, Follicular	Lymphoma	BEFREE	17607588, 2070085, 2787901, 9209369		★☆☆☆☆ Found in Text Mining only
Lymphoma, Lymphocytic, Intermediate	Lymphoma, Lymphocytic, Intermediate	CTD_human_DG	22383795, 26174628		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	BEFREE	12011261, 16774933, 16783567, 1757070, 17607588, 19137297, 2070085, 2078513, 22210878, 2787901, 30967367, 7579380, 7954347, 7981893, 8172823, 9209369, 9766510		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	LHGDN	16783567		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin, Familial	Lymphoma	BEFREE	16783567, 1757070, 17607588, 19137297, 2070085, 22210878, 2787901, 30967367, 7954347, 8172823, 9209369		★☆☆☆☆ Found in Text Mining only
Lymphoma, Small Cleaved-Cell, Follicular	Lymphoma	BEFREE	7981893		★☆☆☆☆ Found in Text Mining only
Lymphoma, T-Cell, Cutaneous	Lymphoma	BEFREE	16614728		★☆☆☆☆ Found in Text Mining only
Lymphoma, T-Cell, Cutaneous	Lymphoma	LHGDN	16614728		★☆☆☆☆ Found in Text Mining only
Lymphoproliferative Disorders	Lymphoproliferative Disorder	BEFREE	10095879, 10471532, 10482984, 11166826, 15029207, 15096562, 7753558, 7772515, 7919385, 8610478, 9067285, 9291459		★☆☆☆☆ Found in Text Mining only
Lymphoproliferative Disorders	Lymphoproliferative syndrome	Pubtator	7919385, 9846986	Associate	★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	18246526		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Major Depressive Disorder	Mental Depression	PSYGENET_DG	18246526		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant Childhood Neoplasm	Malignant Neoplasm	BEFREE	18205772		★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	BEFREE	10416984, 17509221, 21843312		★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	15368064, 15484403, 18349267, 20443083, 23125009, 23400686, 23730900, 25081680, 25516222, 9047388, 9504605, 9736425		★☆☆☆☆ Found in Text Mining only
Malignant lymphoma - lymphocytic, intermediate differentiation	Malignant lymphoma, lymphocytic, intermediate differentiation	BEFREE	8172819, 8280621, 8374527		★☆☆☆☆ Found in Text Mining only
Malignant lymphoma - lymphocytic, intermediate differentiation	Malignant lymphoma, lymphocytic, intermediate differentiation	ORPHANET_DG			★☆☆☆☆ Found in Text Mining only
Malignant lymphoma, lymphocytic, intermediate differentiation, diffuse	Malignant lymphoma, lymphocytic, intermediate differentiation	BEFREE	10085408, 10092070, 10095879, 10233383, 10459355, 10471532, 10482984, 10587706, 10733493, 11485900, 11504842, 11781220, 11863220, 12015751, 12127555, 12135667, 12430874, 12481006, 12515730, 12605034, 12665688, 12970790, 1490145, 15138714, 15226187, 15370207, 15370262, 15381376, 15578074, 15611658, 15628916, 15951302, 16001955, 16082258, 16123218, 16228048, 16373229, 16487171, 16527613, 16614728, 16872438, 17022831, 17316759, 17606765, 17629555, 17638669, 18375822, 18483394, 18552173, 18625744, 18685613, 18798551, 19198627, 19633642, 19783727, 19801969, 19880778, 19880779, 19965626, 20062012, 20062013, 20633772, 20727381, 21119107, 21334716, 21746927, 21790895, 22315488, 22687450, 22706868, 22915650, 23023712, 23255553, 23313364, 23429984, 24060591, 26261659, 26744872, 27025456, 27338091, 27713153, 27810077, 28038705, 28132860, 28296741, 28466437, 29273915, 29898964, 29990311, 30180865, 30211726, 30530749, 31688139, 7531681, 7545645, 7590706, 7591969, 7670110, 7735555, 7753558, 7918073, 7919385, 8172819, 8172823, 8204893, 8280621, 8374527, 8526214, 8573535, 8623758, 8623927, 8649059, 8695815, 8695834, 8729972, 8761301, 8774476, 8797766, 8852399, 8876224, 8907267, 9028328, 9028966, 9067285, 9090492, 9140288, 9184180, 9234379, 9291459, 9376597, 9377576, 9380412, 9573674, 9697882, 9753060, 9766510, 9831207, 9846986		★☆☆☆☆ Found in Text Mining only
Malignant lymphoma, lymphocytic, intermediate differentiation, diffuse	Malignant lymphoma, lymphocytic, intermediate differentiation	LHGDN	12002755, 12127555, 15900590, 15951302, 16123218, 16690963, 17022831, 17299095, 17606765, 17607588, 18798551		★☆☆☆☆ Found in Text Mining only
Malignant lymphoma, lymphocytic, intermediate differentiation, diffuse	Malignant lymphoma, lymphocytic, intermediate differentiation	CTD_human_DG	22383795, 26174628		★☆☆☆☆ Found in Text Mining only
Malignant mesothelioma	Malignant Mesothelioma	BEFREE	22286761		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of brain	Brain Neoplasms	CTD_human_DG	20932960, 27935819		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	10066068, 10208420, 10362141, 10393358, 10887489, 10914724, 11012095, 11110058, 11156526, 11248121, 11263590, 11429595, 11432833, 11449404, 11525606, 11848520, 11870541, 11923474, 11948404, 11956082, 12096344, 12429977, 12448002, 12460907, 12730671, 12738746, 12755491, 12839951, 12917338, 14522919, 14703063, 14712077, 14871808, 15082921, 15138475, 15178330, 15205322, 15322430, 15585484, 1565470, 15668481, 1568216, 15796211, 15845652, 15961768, 15996662, 16061635, 16140974, 16155412, 16260626, 16273236, 16322222, 16331604, 16413469, 16446704, 16465433, 16504004, 16648863, 16809779, 16829689, 16849553, 16860316, 16980581, 17066426, 17088977, 17116943, 17255770, 17278098, 17334399, 17387344, 17486065, 17637757, 17653856, 17909038, 17909257, 18043898, 18067636, 18194538, 18237245, 18240019, 18327210, 18330478, 18341653, 18393977, 18592373, 18632615, 18819000, 19119452, 19142864, 19287456, 19636701, 19726883, 19779113, 19787783, 19855437, 19904758, 19915977, 19941161, 19967453, 20008985, 20038817, 20213079, 20404095, 20406885, 20421209, 20429623, 20525379, 20683061, 2071147, 20971731, 21044962, 21161398, 21327470, 21350001, 21399894, 21401699, 21447726, 21497294, 21503589, 21521417, 21675838, 2181375, 21955753, 22002566, 22037875, 22231956, 22318732, 22465097, 22475046, 22527098, 22538871, 22791882, 22812184, 22863309, 22976805, 23244103, 23321641, 23336272, 23390492, 23516601, 23568005, 23613410, 23636126, 23670132, 23688195, 23786849, 23839043, 23861098, 23938323, 24287487, 24330704, 24345432, 24367492, 24552806, 24606123, 24607787, 24621502, 24785256, 24862872, 25006666, 25313758, 25363551, 25399071, 25657113, 25879784, 25940700, 26397146, 26409837, 26416047, 26431674, 26621531, 26672755, 27208794, 27262171, 27596272, 27668537, 27799526, 28004353, 28123641, 28528450, 28551632, 28893536, 29135104, 29137223, 29140993, 29177689, 29236940, 29246317, 29416786, 29511965, 29693804, 29721077, 30361291, 30463098, 30742303, 30776175, 30816904, 30819233, 31015230, 31023256, 31112577, 31169265, 31243265, 31243808, 31263160, 31426542, 31484966, 31534541, 7546834, 7621424, 7675778, 7687458, 7720042, 7749140, 7942638, 7961120, 8137296, 8168995, 8208295, 8208539, 8336939, 8474448, 8649362, 8797766, 8867812, 9001420, 9065811, 9121767, 9380415, 9500441, 9591636, 9665480, 9747885, 9815758, 9816251, 9816285, 9824849, 9831206		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	CTD_human_DG	12839951, 17255770, 19636701, 20948315, 23839043, 25267515		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of cecum	Cecum cancer	CTD_human_DG	14688030		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	12955092, 14648178, 15069681, 15863141, 18822177, 23733133, 29232554, 29393479, 30585737, 31001342		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	12014632, 12739008, 14606066, 14966901, 16051426, 16732330, 17561354, 21869822, 22150974, 22919244, 22996377, 23020291, 23661400, 24206575, 24810640, 26561473, 28325828, 29673440, 31444279, 7630641, 7747810, 8240318, 8415648, 9042789, 9458316		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	CTD_human_DG	12235107		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	CTD_human_DG	21693435		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	BEFREE	29113352		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of large intestine	Colorectal Neoplasms	BEFREE	9298583		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of larynx	Larynx cancer	BEFREE	12112558, 16258756, 17201183, 19139013, 21193919, 25516222, 27345657, 9816104, 9840520		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	15942670, 17546056, 19118010, 20512928, 26956539, 28415588, 28460446, 29578061, 31667787		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	CTD_human_DG	27064257		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	10101007, 10190311, 10376986, 10964085, 12775733, 12807740, 12867074, 16406195, 16912209, 17011980, 17145885, 17908995, 17922974, 19052819, 19289374, 21636543, 2170896, 21847632, 21965784, 22387541, 22528945, 22534667, 22752428, 22901215, 23184915, 23237220, 23276293, 23563092, 23653001, 23686769, 23776433, 23857284, 23867991, 23873109, 24774443, 24894675, 25754817, 26512878, 26681199, 28821559, 28824300, 29565490, 29739297, 30086699, 30268477, 30317923, 30553472, 30669360, 31399647, 31638210, 31838249, 9192978		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	CTD_human_DG	11307925, 16289808		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	10389982, 10766394, 15791567, 16172916, 16488657, 17893905, 19679297, 20302655, 21273603, 21506129, 21537090, 22321253, 23111452, 24186074, 24675814, 24947332, 25645517, 27653309, 29037125		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of nasopharynx	Nasopharyngeal carcinoma	BEFREE	25516222		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of oropharynx	Malignant Neoplasm Of Oropharynx	BEFREE	30191616		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	10474686, 10727982, 15505422, 15545188, 28521400, 30205383, 30414739, 8607831, 9155044, 9790790		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	10471535, 11751405, 11895107, 19851352, 19966835, 20858281, 22722256, 23019415, 23527134, 24333731, 24468132, 25470788, 27840954, 28990111, 30431107, 31612027, 31846072, 8599583, 9663429		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	10884916, 12455063, 12941814, 14981950, 16267018, 17375037, 17483350, 17606477, 17804732, 19079343, 19269999, 19286570, 19706803, 20028857, 20395447, 20454608, 20822933, 21212260, 22067725, 23060014, 23354566, 24607787, 24739041, 25888980, 26129688, 26497355, 26582866, 27385093, 28345464, 28531799, 28617558, 29453900, 29467540, 29571017, 30278884, 30536619, 30621914, 31309555, 9568672, 9591774, 9873247		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	CTD_human_DG	17606477		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of salivary gland	Malignant neoplasm of salivary gland	CTD_human_DG	16762588		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of skin	Skin cancer	BEFREE	16547504, 21132436		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	11349065, 16490596, 17217616, 17447856, 18609126, 20397048, 23194503, 23383271, 24100731, 24618206, 24623314, 25202078, 25337233, 25586465, 25649416, 25882375, 26791264, 27071318, 27623072, 27798882, 28569779, 28718369, 29104635, 29495973, 30974047, 31249448		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	CTD_human_DG	21628965		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	20372070, 29269566, 30428594, 31304680		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of tongue	Malignant Neoplasm Of Tongue	BEFREE	11566495, 25645517		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	10473073, 11872630, 12237776, 12372886, 12394763, 12896908, 14648664, 15245939, 15390184, 15590562, 18361427, 20380574, 20575692, 21766505, 21789902, 23887292, 23893383, 24264314, 24324055, 25556372, 25888950, 28109084, 30104251, 30387807, 30446453, 31164795, 8622895, 9192983, 9815621		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	10037171, 10068276, 10208420, 10225453, 10471532, 10474686, 10482983, 10597234, 10667569, 10783304, 10928172, 11166826, 11429595, 11595705, 11676861, 11698342, 11932322, 12014632, 12097293, 12200702, 12372886, 12432268, 12569141, 12694349, 12896908, 12914697, 12951064, 14529567, 1461646, 14648178, 14654791, 14703063, 14712077, 14714130, 14981950, 15004225, 15063389, 15090460, 15226187, 15229656, 1535701, 15370262, 15545188, 15580291, 15637397, 15754315, 15864317, 15900590, 16051426, 16187023, 16258756, 16413464, 16522546, 16550162, 16691558, 16731743, 16732330, 16760651, 16829689, 17223847, 17341611, 17359287, 17407548, 17447856, 17498553, 17561354, 1757070, 17607588, 17947490, 18061526, 18205772, 18598945, 18640142, 18794151, 18818515, 18829570, 18843022, 19084934, 19118010, 19139013, 19270644, 19276161, 19703993, 19787783, 19917254, 19960539, 20538607, 20680537, 2071147, 2078513, 21107342, 21278493, 21350001, 21498736, 21521417, 21537090, 21654808, 2170896, 21734724, 21777578, 21789902, 22002566, 22110187, 22213296, 22304571, 22307325, 22351518, 22410463, 22467868, 22606291, 22792274, 22996917, 23022476, 23023712, 23135283, 23225431, 23318178, 23320102, 23328252, 23383150, 23613410, 23670132, 23723126, 23962569, 24019069, 24324055, 24552806, 24660968, 24704453, 24712725, 2476705, 25053516, 25146682, 25230850, 25292026, 25297608, 25409185, 25524798, 25550229, 25702703, 26055143, 26125710, 26125784, 26129688, 26246306, 26397146, 26415226, 26689992, 26699502, 26979757, 27105504, 27129163, 27155130, 27258148, 27385093, 27401254, 27596272, 2790203, 27965308, 28134728, 28522753, 28569510, 28824300, 28980866, 29049220, 29059158, 29137220, 29238002, 29273857, 29298515, 29340077, 29483206, 29511965, 29578061, 29880532, 29885057, 29969496, 30003391, 30138655, 30361291, 30389902, 30655753, 30736802, 30851420, 30899002, 31048690, 31072811, 31184805, 31222938, 31252679, 31364108, 31444279, 31491872, 31659203, 31705880, 31838249, 7504521, 7533528, 7585513, 7607576, 7630641, 7647309, 7772515, 7819051, 7898937, 7919385, 8062825, 8102560, 8247550, 8607831, 8740788, 8760592, 8826947, 8832554, 8939849, 9028328, 9038263, 9155044, 9192552, 9568672, 9624412, 9626342, 9720584, 9790790, 9816104, 9879290, 9893652		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	CGI_DG			★☆☆☆☆ Found in Text Mining only
Malignant Peripheral Nerve Sheath Tumor	Malignant Peripheral Nerve Sheath Tumor	BEFREE	10595919, 15715087, 18413802, 26740486, 29020982, 29332262		★☆☆☆☆ Found in Text Mining only
Malignant Squamous Cell Neoplasm	Neoplasm	BEFREE	10474686, 10690551, 12807740, 8426754, 8453274		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	11371120, 15221962, 15896460, 15949570, 16865248, 19489683, 19585495, 20473525, 20680537, 21594903, 23111469, 24737585, 25204741, 26631043, 27364926, 27732565, 28521400, 29416780, 30198868, 30361291, 30903019, 31695498		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	11507050, 15004225, 19232344, 19415698, 19440933, 19549773, 19572978, 20332435, 20950152, 22884800, 22886548, 23464457, 23567490, 24454732, 25229241, 27191497, 28492347, 28684297, 30091007, 30462152		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	CTD_human_DG	18283038, 19147571, 21081470, 21188121		★☆☆☆☆ Found in Text Mining only
Mammary Carcinoma, Human	Marfan Syndrome	CTD_human_DG	12839951, 17255770, 19636701, 20948315, 23839043, 25267515		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	10070974, 10393358, 10915780, 11477142, 11870541, 12032322, 12101225, 1350457, 15314168, 15322430, 16536875, 16980615, 18341653, 18695042, 19142864, 21327470, 22002566, 22231956, 23336272, 23928992, 24367492, 30819233, 8649362, 8797862, 9652762, 9669664, 9865902		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	11948404, 12007188, 12096344, 12444551, 12738746, 12883688, 15282324, 15735724, 15861516, 17116943, 17344214, 17486065, 17653856, 17935714, 17941827, 18043898, 18237245, 18240019, 18347178, 18413773, 18456656, 18632615, 19124506		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	CTD_human_DG	12839951, 17255770, 19636701, 20948315, 23839043, 25267515		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms, Human	Mammary Neoplasms	CTD_human_DG	12839951, 17255770, 19636701, 20948315, 23839043, 25267515		★☆☆☆☆ Found in Text Mining only
Mantle cell lymphoma	Mantle Cell Lymphoma	BEFREE	10085408, 10092070, 10095879, 10223569, 10233383, 10319380, 10319386, 10361135, 10459355, 10471532, 10482984, 10510675, 10557044, 10587706, 10602433, 10627471, 10707794, 10733493, 10793062, 10941340, 10980628, 11159766, 11166826, 11193469, 11235907, 11245476, 11260626, 11426530, 11485900, 11504842, 11598173, 11781220, 11793447, 11823969, 11863220, 11986399, 12011256, 12011261, 12015751, 12127555, 12127561, 12135667, 12153164, 12154046, 12162681, 12237233, 12411587, 12430874, 12481006, 12515730, 12605034, 12620412, 12665688, 12683869, 12728315, 12742154, 12827658, 12952233, 12970790, 14608537, 14678979, 14767533, 1490145, 15029207, 15096562, 15131039, 15138714, 15194536, 15226187, 15306823, 15370207, 15370262, 15381376, 15578074, 15608680, 15611658, 15628916, 15900590, 15951302, 15982342, 16001955, 16082258, 16123218, 16155021, 16183118, 16228048, 16258956, 16280660, 16373229, 16448697, 16487171, 16527613, 16614728, 16690963, 16872438, 16925576, 17022831, 17148679, 17296973, 17299095, 17300675, 17316759, 17556072, 17606765, 17614761, 17629555, 17638669, 17934069, 18024791, 18303407, 18375822, 18382373, 18391076, 18483394, 18524848, 18552173, 18587018, 18625744, 18684040, 18685613, 18709664, 18798551, 19137297, 19198627, 19362399, 19477219, 19633642, 19704260, 19783727, 19801969, 19823025, 19826251, 19880778, 19880779, 19965626, 20002441, 20008239, 20038219, 20062012, 20062013, 20086245, 20126990, 20459741, 20490333, 20633772, 20727381, 20919851, 21119107, 21133727, 21334716, 21344225, 21345142, 21394647, 21479697, 21504716, 21677543, 21745168, 21746927, 21782056, 21782057, 21790895, 21851218, 21945515, 22042694, 22210878, 22259787, 22315488, 22592113, 22687450, 22706868, 22827557, 22915650, 22944294, 23020673, 23023712, 23255553, 23313364, 23330001, 23429984, 23580240, 23666700, 23754783, 23962569, 24060591, 24071012, 24145648, 24166616, 24178620, 24352646, 24352880, 24452204, 24677400, 24817983, 25015778, 25315075, 25596256, 25755704, 25944379, 26073757, 26261659, 26298543, 26439697, 26699502, 26744872, 26774800, 26985765, 27025456, 27121112, 27338091, 27407063, 27430213, 27713153, 27720733, 27810077, 28028120, 28032914, 28038705, 28109040, 28132860, 28140709, 28296741, 28466437, 28628241, 28797244, 28974340, 29066743, 29273915, 29520657, 29755111, 29898964, 29990311, 30132080, 30180865, 30211726, 30465121, 30530749, 30538135, 30701029, 30857748, 30963600, 30967367, 31054894, 31120355, 31229158, 31433838, 31517438, 31688139, 31786879, 7531681, 7534138, 7545645, 7579380, 7590706, 7591969, 7612496, 7670110, 7735555, 7753558, 7772515, 7918073, 7919385, 8086622, 8123854, 8142653, 8172819, 8172823, 8204893, 8280621, 8374527, 8526214, 8547115, 8573535, 8605352, 8608242, 8623758, 8623927, 8649059, 8659449, 8695815, 8695834, 8729972, 8740788, 8761301, 8774476, 8797766, 8852399, 8876224, 8907267, 8978301, 9028328, 9028966, 9067285, 9090492, 9140288, 9184180, 9234379, 9291459, 9376597, 9377576, 9380412, 9573674, 9674745, 9697882, 9739021, 9753060, 9766510, 9831207, 9846986, 9917131, 9949176, 9949181		★☆☆☆☆ Found in Text Mining only
Mantle cell lymphoma	Mantle Cell Lymphoma	Orphanet			★☆☆☆☆ Found in Text Mining only
Marginal Zone B-Cell Lymphoma	B-Cell Lymphoma	BEFREE	16847683, 17018901, 17316759, 20727381		★☆☆☆☆ Found in Text Mining only
Mediastinal (Thymic) Large B-Cell Lymphoma	B-Cell Lymphoma	BEFREE	30211726		★☆☆☆☆ Found in Text Mining only
Medullary carcinoma	Megalencephaly, Polymicrogyria, Polydactyly, Hydrocephalus Syndrome	BEFREE	11836618		★☆☆☆☆ Found in Text Mining only
Medullary carcinoma of thyroid	Megalencephaly, Polymicrogyria, Polydactyly, Hydrocephalus Syndrome	BEFREE	31352037		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	16156230, 19147556, 19293793, 22682621, 27966820, 28856557, 28915627		★☆☆☆☆ Found in Text Mining only
Melanocytic nevus	Melanocytic nevus	BEFREE	12942578, 19404853, 20100177, 22211292		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	10594749, 10727462, 16098043, 16291983, 16815849, 17482134, 17488338, 18790768, 19633643, 20304954, 20496072, 21300445, 21983787, 22311377, 23001925, 23362874, 23664541, 23800576, 24374110, 24885594, 26307133, 28067893, 28870692, 29286144, 29858490, 30569211, 30657954, 31292999, 31801187, 32374893, 32933177, 33067454, 33419898, 33917086, 34225728, 34483446, 34898573, 35484605, 36303457, 36739402, 37301510, 38031947, 8611425	Associate	★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	11175636, 12036934, 12224020, 15547691, 15703813, 16291983, 16301388, 16523260, 16916716, 16924241, 17363583, 17525627, 18790768, 19404853, 19606012, 19788535, 20100177, 20496072, 21300445, 22211292, 22250051, 22456513, 22588064, 22614973, 22892832, 23001925, 23278726, 23355370, 23537197, 23664541, 23685997, 23800576, 25149154, 26766120, 26988987, 27061029, 28829835, 28870692, 29121869, 29344161, 29858490, 8611425		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	LHGDN	12036934, 12894561, 16924241		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	22614973, 23424770	Stimulate	★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	CGI_DG			★☆☆☆☆ Found in Text Mining only
Melanoma Cutaneous Malignant	Melanoma	Pubtator	23001925, 36939129	Associate	★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	LHGDN	17240151, 18379871		★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	Pubtator	18379871, 19703993, 32810829, 37686289	Associate	★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	BEFREE	18981889, 19703993		★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	22760121, 25358426		★☆☆☆☆ Found in Text Mining only
Merkel cell carcinoma	Merkel cell carcinoma	BEFREE	25277525		★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	BEFREE	12643444, 22110187		★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	18194492, 27864821		★☆☆☆☆ Found in Text Mining only
Metaphyseal chondrodysplasia	Metaphyseal Chondrodysplasia	BEFREE	12198252		★☆☆☆☆ Found in Text Mining only
Microcystic stromal tumor	Microcystic Stromal Tumor	BEFREE	30325056		★☆☆☆☆ Found in Text Mining only
Miller Dieker syndrome	Miller Dieker Syndrome	BEFREE	19813013		★☆☆☆☆ Found in Text Mining only
Milroy Disease	Milroy Disease	BEFREE	15543617		★☆☆☆☆ Found in Text Mining only
Mongolian Spot	Mongolian Spot	BEFREE	19606012		★☆☆☆☆ Found in Text Mining only
Monoclonal Gammopathy of Undetermined Significance	Monoclonal Gammapathies	BEFREE	16155016, 19996118		★☆☆☆☆ Found in Text Mining only
Mouth Diseases	Mouth disease	Pubtator	16334163, 16616093, 18823025, 19623652, 21990607, 22311377, 34762658, 35488777	Associate	★☆☆☆☆ Found in Text Mining only
Mouth Diseases	Mouth disease	Pubtator	20062011	Inhibit	★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth neoplasm	Pubtator	11267947, 15731778, 16007067, 16334163, 20302655, 21537090, 23554211, 26459309, 27031247, 29037125, 29516928, 30138436, 30459815, 36761830	Associate	★☆☆☆☆ Found in Text Mining only
Mouth Neoplasms	Mouth Neoplasms	LHGDN	15791567, 18061526		★☆☆☆☆ Found in Text Mining only
Mucinous Adenocarcinoma	Mucinous Adenocarcinoma	BEFREE	11836618		★☆☆☆☆ Found in Text Mining only
Mucoepidermoid Carcinoma	Mucoepidermoid Carcinoma	BEFREE	17315172		★☆☆☆☆ Found in Text Mining only
Mucopolysaccharidoses	Mucopolysaccharidosis	Pubtator	36000158	Associate	★☆☆☆☆ Found in Text Mining only
Mucopolysaccharidosis III	Mucopolysaccharidosis	Pubtator	26681199	Associate	★☆☆☆☆ Found in Text Mining only
Mucosa-Associated Lymphoid Tissue Lymphoma	Mucosa-associated lymphoma	BEFREE	12231535, 16847683, 17300675, 17316759, 20727381, 9395180, 9543667		★☆☆☆☆ Found in Text Mining only
Multiple Endocrine Neoplasia Type 1	Multiple Endocrine Neoplasia	BEFREE	15153436, 1684084, 19238077, 22855342, 24035866, 7541648		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	10024885, 10223569, 10319380, 10753852, 10793062, 10848779, 10874884, 11154227, 11260083, 11418483, 11552984, 11601138, 11840272, 11861292, 11872077, 11986230, 12200702, 12448002, 12707028, 12730120, 12824903, 12846810, 1415486, 14531906, 14697640, 15090448, 15090460, 1520625, 15226187, 15289859, 15543617, 15755896, 15911089, 16129847, 16155016, 16479154, 16627271, 17022831, 17284370, 17460451, 17498561, 17629555, 18216867, 18274833, 18625744, 19020753, 19129688, 19362368, 19801969, 20459741, 20578819, 20633772, 21272268, 22558078, 22565393, 23174883, 23460268, 23502783, 24468132, 25422161, 25881299, 26125784, 26976208, 27286258, 27810077, 27919956, 28025584, 28775176, 29403080, 30214285, 31218784, 8610478, 8695815, 8892624, 9324302, 9865713, 9949176		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Myeloma	Multiple myeloma	Pubtator	10086803, 10753852, 10793062, 10848779, 11154227, 11260083, 11418483, 11552984, 11986230, 12730120, 14531906, 15090460, 15226187, 15339850, 15755896, 15911089, 16728703, 17022831, 17303695, 17914559, 18553158, 18625744, 19446321, 20093236, 20511669, 20709908, 21173094, 22565393, 23502783, 24638926, 25881299, 26935956, 27146121, 27223072, 27286258, 27319807, 27863383, 29403080, 29969371, 31218784, 32145384, 32386081, 33046520, 33138842, 33338886, 33392515, 33530159, 33664418, 34521827, 36262053, 37452600, 8695815, 9359513	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Myeloma	Multiple myeloma	Pubtator	11861292, 19801969, 9548443	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Myeloma	Multiple myeloma	LHGDN	12231535, 12707028, 15203873, 17022831, 19020753, 19129688		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Myeloma	Multiple myeloma	GWASCAT_DG	23502783		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Myeloma	Multiple myeloma	ORPHANET_DG	23502783		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Myeloma	Multiple myeloma	GWASDB_DG	23502783		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Myeloma	Multiple myeloma	CTD_human_DG	23502783		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple myeloma	Multiple myeloma	Orphanet			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Myeloma	Multiple myeloma	HPO_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple renal cysts	Multiple renal cysts	HPO_DG			★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	17395275, 22042694		★☆☆☆☆ Found in Text Mining only
Muscular Dystrophy Emery Dreifuss	Emery dreifuss muscular dystrophy	Pubtator	36657019	Associate	★☆☆☆☆ Found in Text Mining only
Mycosis Fungoides	Mycosis fungoides	Pubtator	16614728	Stimulate	★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	10459355, 19813013, 22524974, 23320102		★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	LHGDN	12965081		★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	22524974	Associate	★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia	Myeloid Leukemia	BEFREE	12921950		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia	Myeloid Leukemia	LHGDN	12921950		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	15621754, 16334487, 18537972, 24806995, 27716259, 27810077, 31646577		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	LHGDN	15621754		★☆☆☆☆ Found in Text Mining only
MYELOPROLIFERATIVE SYNDROME, TRANSIENT	Myeloproliferative disorder	BEFREE	26200099		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	28453729, 9437197		★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial Ischemia	CTD_human_DG	16214533		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myoclonic dystonia	Myoclonic dystonia	Pubtator	10233383	Associate	★☆☆☆☆ Found in Text Mining only
Myoclonic dystonia	Myoclonic dystonia	Pubtator	11260083, 8573535	Stimulate	★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	10929762, 16166286, 16691558, 19203829, 19430707, 22399638, 22739938, 23161911, 23270726, 23708661, 24499623, 24615109, 24751144, 25109634, 25409185, 25516222, 26276746, 27258148, 27816050, 28656063, 29789630, 30236142, 31303793		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	10929762, 12181248, 19430707, 22727408, 23382914, 24499623, 24615109, 24751144, 25109634, 25337187, 26795575, 27451945, 27816050, 28581676, 29367693, 29991129, 30950204, 31841193, 32083569, 34165442, 34224316, 37257705	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	CTD_human_DG	24952746		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	32697404	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nasopharyngeal Neoplasms	Nasopharyngeal carcinoma	Pubtator	10929762, 32778629	Associate	★☆☆☆☆ Found in Text Mining only
Neck Neoplasms	Neck Neoplasms	BEFREE	12148857, 15942670, 25454347		★☆☆☆☆ Found in Text Mining only
Nemaline myopathy 5	Nemaline myopathy	Pubtator	19305381	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10029404, 10037001, 10037171, 10101007, 10190311, 10216470, 10231419, 10319380, 10329038, 10362085, 10362141, 10376532, 10376986, 10403840, 10419526, 10419705, 10473097, 10474686, 10498401, 10534337, 10574596, 10584879, 10597234, 10613309, 10690551, 10727982, 10896772, 10928132, 10928172, 10944553, 10955801, 10964085, 10969768, 10975609, 11041450, 11095482, 11156526, 11221853, 11286838, 11288983, 11290553, 11309340, 11311493, 11341347, 11371120, 11408803, 11418483, 11470742, 11477142, 11568558, 11570573, 11696452, 11698342, 11706744, 11720473, 11781220, 11836618, 11932322, 11943721, 12007188, 12040434, 12112558, 12133540, 12138206, 12148857, 12202983, 12203362, 12209953, 12224020, 12231535, 12352189, 12412169, 12412775, 12432268, 12472286, 12514403, 12533831, 12557224, 12571275, 12606626, 12738730, 12738746, 12741684, 12778072, 12798405, 12827612, 12846810, 12894578, 12941814, 12955092, 1394169, 14517841, 14563949, 14581353, 14586645, 14608537, 1461646, 14633785, 14645696, 14648178, 14657069, 14666635, 14678979, 14697505, 14714130, 14724365, 14724563, 14976524, 14976537, 14999152, 15036887, 15063391, 15069681, 15082203, 15090448, 15095259, 15098257, 15117986, 15133490, 15138475, 15205322, 15289739, 15300811, 15314168, 15350626, 15390184, 15476271, 15543620, 15544931, 15545188, 15547691, 15557752, 15574759, 15578074, 15611645, 15611658, 15671551, 15695117, 15715087, 15735746, 15755896, 15824151, 15846391, 15900590, 15961768, 15981100, 15991006, 15994955, 16053486, 16098043, 16140974, 16158183, 16166286, 16187023, 16230611, 16265665, 16270038, 16402339, 16479604, 16482499, 16482519, 16490172, 16531763, 16596306, 16614946, 16644573, 16648863, 16713561, 16732330, 16740029, 16809779, 1682919, 16849553, 16860316, 16864578, 16872438, 16899623, 16969111, 16982753, 17036332, 17079480, 17097874, 17139501, 17197928, 17201183, 17223847, 17278089, 17316759, 17359287, 17375037, 17376508, 17398034, 17460451, 17482347, 17561354, 17600882, 17617377, 17632456, 17704717, 17906980, 18008375, 18032022, 18043898, 18341653, 18355450, 18381641, 18381935, 18398503, 18413827, 18550246, 18592373, 18629779, 18704459, 18708753, 18752864, 18760195, 18793406, 18818515, 18955789, 19084934, 19088048, 19118010, 19124506, 19147556, 19208363, 19232344, 19248223, 19276245, 19360297, 19412426, 19549253, 19549773, 19554511, 19633643, 19636701, 19724860, 19778454, 19787783, 19855437, 19874313, 19882219, 19893027, 19896697, 19904758, 19963116, 20043093, 2011398, 2011400, 20139910, 20154722, 20306448, 20361361, 20395447, 20397048, 20484017, 20529342, 20540739, 20562919, 20676758, 20682066, 20801098, 20858281, 20971731, 21132436, 21152316, 21185249, 21212260, 21254295, 21327470, 21330408, 21378327, 21447152, 21477609, 21497294, 21498736, 21509525, 21532889, 21537090, 21636548, 21642382, 21677543, 21705050, 21746927, 21809352, 2181375, 21910158, 21911485, 21928377, 21989926, 22024187, 22037217, 22037875, 22105368, 22145922, 22231956, 22296356, 22304571, 22321253, 22322893, 22406359, 2242428, 22510564, 22564524, 22705236, 22722256, 22733500, 22812184, 22894905, 22911754, 22967707, 23037503, 23043547, 23111469, 23133595, 23144318, 23238983, 23318451, 23328252, 23336272, 23515614, 23562784, 23568005, 23599173, 23616356, 23670132, 23764725, 23786849, 23887292, 23928992, 24008375, 24019069, 24080207, 24104354, 24107628, 24145436, 24190141, 24236567, 24257751, 24260413, 24300090, 24313652, 24403468, 24468132, 24570185, 24614362, 24675814, 24742286, 24755523, 2476705, 24777966, 24816720, 24862872, 24885829, 24930892, 24943192, 24991826, 25015194, 25025452, 25130488, 25200445, 25214561, 25231129, 25297608, 25313758, 2540855, 25431235, 25454347, 25801820, 25889927, 25933206, 26118774, 26124319, 26233522, 26314265, 26409837, 26498689, 26654598, 26722434, 26744872, 26766120, 26775675, 26791264, 26943575, 27091484, 27145270, 27181366, 27190992, 27226604, 27270423, 27334220, 27351279, 27431575, 27440272, 27566107, 27726892, 27750372, 27803295, 27854312, 2787901, 27910734, 27973759, 28036267, 28069005, 28086833, 28171849, 28264020, 28269750, 28284729, 28342098, 28349562, 28460446, 28528450, 28551389, 28591705, 28598010, 28617558, 28649475, 28764703, 28775176, 28885717, 28911002, 28943959, 28965628, 29135104, 2915903, 29177689, 29262567, 29269566, 29352223, 29483206, 29689276, 29693134, 29747488, 29792909, 29872083, 29880532, 29938829, 29990311, 30003391, 30076862, 30100758, 30210237, 30224477, 30236142, 30320392, 30365098, 30414739, 30428594, 30467700, 30551398, 30562012, 30562739, 30585737, 30588951, 30646811, 30651863, 30685130, 30705512, 30718512, 30720124, 30742303, 30776175, 30801954, 30859089, 30883338, 30941985, 31006846, 31018208, 31023256, 31115554, 31183974, 31270760, 31321645, 31567982, 31611744, 31667787, 31673890, 31726654, 31751608, 31822509, 31837005, 3923362, 7504521, 7534138, 7541648, 7545645, 7621424, 7630641, 7640224, 7647309, 7670110, 7675778, 7687458, 7720042, 7812927, 7819051, 7866635, 7927946, 7942638, 7961120, 8004570, 8036001, 8062283, 8062825, 8195927, 8200932, 8203469, 8204893, 8205525, 8208295, 8240318, 8247550, 8275473, 8290586, 8318919, 8415648, 8426754, 8453274, 8481900, 8499640, 8526214, 8529470, 8562333, 8599583, 8621248, 8622895, 8623758, 8623927, 8649851, 8695815, 8729983, 8797862, 8826947, 8832554, 8902564, 9001420, 9010112, 9028966, 9038263, 9057657, 9065811, 9133450, 9192552, 9192983, 9234379, 9274525, 9291459, 9294609, 9302564, 9333020, 9422532, 9426048, 9462706, 9504605, 9568672, 9591537, 9591636, 9598804, 9615803, 9624412, 9626342, 9626345, 9666346, 9685701, 9720584, 9722210, 9759649, 9769125, 9796972, 9815621, 9815783, 9816104, 9816285, 9829720, 9949176, 9949353, 9973108		★☆☆☆☆ Found in Text Mining only
Neoplasms, Intracranial	Intracranial Neoplasm	CTD_human_DG	20932960, 27935819		★☆☆☆☆ Found in Text Mining only
Nephroblastoma	Nephroblastoma	BEFREE	25751590, 30736802		★☆☆☆☆ Found in Text Mining only
Nephrotic Syndrome	Nephrotic Syndrome	BEFREE	18343955		★☆☆☆☆ Found in Text Mining only
Nephrotic Syndrome	Nephrotic Syndrome	HPO_DG			★☆☆☆☆ Found in Text Mining only
Neurilemmoma	Neurilemmoma	BEFREE	22247700, 23318455		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	11986399, 17384216, 18413728, 18980998, 21290341, 23144874, 23892435, 26067621, 30736802	Associate	★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	12557224, 15314161, 17637757, 18413728, 20154722, 23144874, 23892435, 25751590, 26067621, 26510683, 30405823, 30736802, 8318919		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	LHGDN	12557224		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	20506465	Associate	★☆☆☆☆ Found in Text Mining only
Neuroectodermal Tumor, Primitive	Neuroectodermal Tumors	BEFREE	19147556		★☆☆☆☆ Found in Text Mining only
Neuroendocrine Tumors	Neuroendocrine Tumors	BEFREE	15153436, 15580291, 17632456, 26434631, 28991877		★☆☆☆☆ Found in Text Mining only
neurofibroma	Neurofibroma	BEFREE	10595919, 26740486		★☆☆☆☆ Found in Text Mining only
Neurofibromatoses	Neurofibromatosis	BEFREE	10595919, 26740486		★☆☆☆☆ Found in Text Mining only
Neurofibromatosis 1	Neurofibromatosis	BEFREE	26479420, 26740486, 29020982		★☆☆☆☆ Found in Text Mining only
Neurofibromatosis 2	Neurofibromatosis	Pubtator	38115252	Associate	★☆☆☆☆ Found in Text Mining only
Neurofibrosarcoma	Neurofibrosarcoma	Pubtator	18413802, 19414372, 23434321, 29020982, 29332262, 30883338	Associate	★☆☆☆☆ Found in Text Mining only
Nevi and Melanomas	Congenital melanocytic nevus syndrome	BEFREE	12942578, 20100177		★☆☆☆☆ Found in Text Mining only
Nevus, Blue	Blue Nevus	BEFREE	19606012, 26766120		★☆☆☆☆ Found in Text Mining only
Nodular Lymphocyte Predominant Hodgkin Lymphoma	Classical Hodgkin lymphoma	BEFREE	28038705		★☆☆☆☆ Found in Text Mining only
Non-Functioning Pituitary Gland Neoplasm	Pituitary adenoma	BEFREE	29344143		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	10190311, 10376986, 11282426, 11679179, 12775733, 16406195, 17070615, 19289374, 20631637, 21847632, 22024187, 22110187, 22133292, 22387541, 22534667, 23396251, 23423709, 23776433, 23936312, 24774443, 26055143, 26212035, 26497851, 26802652, 26840018, 27035641, 27166267, 27431575, 27494902, 27498289, 27596264, 27988424, 28372542, 28377627, 28634225, 28824300, 28933981, 29029423, 29362431, 29731854, 29885057, 30275712, 30553472, 30718506, 31115012, 31321645, 31737192, 8562333, 9192978, 9462706, 9796972, 9815783		★☆☆☆☆ Found in Text Mining only
Noninfiltrating Intraductal Carcinoma	Ductal carcinoma	BEFREE	10066068, 10398079, 10752677, 11836618, 12446956, 12825853, 14612904, 17316413, 21401699, 26884359, 9212742, 9652762, 9831206, 9893652		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	12029453, 18246526, 23311506, 26709918, 29511965, 31188872		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	29511965, 29620215	Associate	★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	29546532	Stimulate	★☆☆☆☆ Found in Text Mining only
Obstructive azoospermia	Obstructive azoospermia	BEFREE	30513418		★☆☆☆☆ Found in Text Mining only
Ocular Hypertension	Ocular Hypertension	BEFREE	17563720		★☆☆☆☆ Found in Text Mining only
Oestrogen receptor positive breast cancer	Oestrogen Receptor Positive Breast Cancer	BEFREE	11410592, 16980581, 17178859, 17653856, 17909257, 18240019, 19904758, 23670132, 23839043, 25200445, 28528450, 31742207, 8797862		★☆☆☆☆ Found in Text Mining only
oligodendroglioma	Oligodendroglioma	BEFREE	29489901		★☆☆☆☆ Found in Text Mining only
Oligodendroglioma	Oligodendroglioma	Pubtator	29489901	Associate	★☆☆☆☆ Found in Text Mining only
Oncocytoma, renal	Oncocytoma of kidney	BEFREE	19386349, 30072012		★☆☆☆☆ Found in Text Mining only
Oral Mucositis	Oral Mucositis	BEFREE	28445979		★☆☆☆☆ Found in Text Mining only
Oral Submucous Fibrosis	Oral Submucous Fibrosis	BEFREE	27497264		★☆☆☆☆ Found in Text Mining only
Oral Submucous Fibrosis	Oral submucous fibrosis	Pubtator	27497264	Associate	★☆☆☆☆ Found in Text Mining only
Oropharyngeal Carcinoma	Oropharyngeal Carcinoma	BEFREE	14759115, 24425835, 30191616		★☆☆☆☆ Found in Text Mining only
Oropharyngeal Neoplasms	Oropharyngeal neoplasm	Pubtator	19221247, 23672832, 30189895	Associate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	27307355, 29806631, 31155960, 31773673	Associate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis, Knee	Knee osteoarthritis	BEFREE	27391794		★☆☆☆☆ Found in Text Mining only
Osteogenesis Imperfecta	Osteogenesis imperfecta	Pubtator	29069035	Associate	★☆☆☆☆ Found in Text Mining only
Osteonecrosis	Osteonecrosis	Pubtator	35035862	Associate	★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	40517505	Associate	★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	17640297, 23568006, 24025361, 24942472, 27338044, 27813492, 28539830, 28924379, 30226542, 31974626, 35263402, 38031136	Associate	★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	22922827, 23568006, 24218283, 24565852, 24694542, 25530340, 25823925, 26134785, 27221371, 28260005, 28492139, 28539830, 30127935, 30365098, 30546411, 31262893, 31393166, 7585620, 8052269		★☆☆☆☆ Found in Text Mining only
Otodental Dysplasia	Otodental dysplasia	Pubtator	32145384, 7961120, 8204893	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Carcinoma	Ovarian Carcinoma	BEFREE	15505422		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ovarian neoplasm	Ovarian neoplasm	BEFREE	10329035, 12937139, 15545188, 21152316, 23209312, 28521400, 30205383, 30414739, 8607831, 9155044, 9790790		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	LHGDN	12759391, 15297421, 16174239		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	10584879, 11943708, 15028555, 19258477, 21458521, 22312289, 23200915, 23345014, 24427347, 26526575, 26823747, 27831653, 28508842, 28983627, 29752805, 29758922, 30205383, 31709901, 32502299, 32622365, 32660514, 32706063, 32948241, 33489719, 34806539, 35351053, 35739532, 9155044	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	20395447	Stimulate	★☆☆☆☆ Found in Text Mining only
Oxyphilic Adenoma	Oxyphilic Adenoma	BEFREE	16337860		★☆☆☆☆ Found in Text Mining only
PACHYONYCHIA CONGENITA 3	Pachyonychia Congenita	BEFREE	30153964		★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	10471535, 11590324, 11751405, 11895107, 19851352, 19966835, 20858281, 22722256, 23019415, 23527134, 24333731, 24468132, 25470788, 27840954, 28990111, 30431107, 31612027, 31846072, 9134998, 9663429		★☆☆☆☆ Found in Text Mining only
Pancreatic Cyst	Pancreatic Cyst	HPO_DG			★☆☆☆☆ Found in Text Mining only
Pancreatic Ductal Adenocarcinoma	Pancreatic adenocarcinoma	BEFREE	11102889, 17600882, 20113529		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	LHGDN	19106744		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	BEFREE	22722256, 8599583		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	HPO_DG			★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	11469683, 15810077, 17632456, 19851352, 19966835, 20630061, 22119988, 22393285, 25577248, 27840954, 29117940, 29486633, 30374056, 32537471, 33008376, 35269749, 40294979	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	21196815	Stimulate	★☆☆☆☆ Found in Text Mining only
Pancreatitis, Chronic	Pancreatitis	BEFREE	9700947		★☆☆☆☆ Found in Text Mining only
Papillary cystadenoma of the epididymis	Papillary cystadenoma of the epididymis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	15095272, 16772349, 17916995, 21389096, 24121026, 25227811, 25907675, 26323637, 28270228, 29250166, 29520684, 30034553, 9949353		★☆☆☆☆ Found in Text Mining only
Papilloma	Papilloma	BEFREE	11912134, 25572123, 27148699		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Papilloma	Papilloma	CTD_human_DG	12151359		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Papilloma	Papilloma	Pubtator	23327593	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Papilloma, Squamous Cell	Papilloma	CTD_human_DG	12151359		★☆☆☆☆ Found in Text Mining only
Papillomatosis	Papillomatosis	CTD_human_DG	12151359		★☆☆☆☆ Found in Text Mining only
Paraganglioma	Paraganglioma	BEFREE	24390213		★☆☆☆☆ Found in Text Mining only
Paraganglioma	Paraganglioma	HPO_DG			★☆☆☆☆ Found in Text Mining only
Paramyotonia Congenita (disorder)	Paramyotonia Congenita	BEFREE	17916995		★☆☆☆☆ Found in Text Mining only
Paraproteinemias	Paraproteinemia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Parathyroid Adenoma	Parathyroid Adenoma	BEFREE	10704427, 11167122, 11290553, 11836555, 12412775, 1532244, 1535701, 1591003, 1682919, 18398822, 19373510, 2011400, 20641034, 22855342, 23660642, 23715670, 27071708, 28600574, 7621424, 7675778, 7687458, 7812927, 8200932, 8302597, 8426754, 8453274, 8625145, 8626826, 8855819		★☆☆☆☆ Found in Text Mining only
Parathyroid Gland Adenocarcinoma	Parathyroid Gland Adenocarcinoma	BEFREE	14694525, 23616356, 24510244, 28949121, 7906387, 8200932, 8626826		★☆☆☆☆ Found in Text Mining only
Parathyroid hyperplasia	Parathyroid hyperplasia	BEFREE	15225829		★☆☆☆☆ Found in Text Mining only
Parathyroid Neoplasms	Parathyroid neoplasm	Pubtator	10201002, 11290553, 1682919, 20641034, 22855342, 28066056, 28352668, 28600574, 34054720, 7906387	Associate	★☆☆☆☆ Found in Text Mining only
Parathyroid Neoplasms	Parathyroid Neoplasms	BEFREE	10395244, 10423035, 10704427, 11290553, 15105644, 15580289, 15757864, 17359287, 2011400, 20641034, 7593409, 7621424, 7866635, 8564978, 8626826, 8981014		★☆☆☆☆ Found in Text Mining only
Parathyroid Neoplasms	Parathyroid Neoplasms	LHGDN	11836555		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	34204164	Associate	★☆☆☆☆ Found in Text Mining only
Pelvic Inflammatory Disease	Pelvic inflammatory disease	Pubtator	2540855	Associate	★☆☆☆☆ Found in Text Mining only
Penile Neoplasms	Penile neoplasm	Pubtator	17695500	Associate	★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	Pubtator	40294979	Associate	★☆☆☆☆ Found in Text Mining only
Peripheral Arterial Diseases	Vascular Diseases	BEFREE	7600117		★☆☆☆☆ Found in Text Mining only
Peripheral T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	22770229		★☆☆☆☆ Found in Text Mining only
Peripheral Vascular Diseases	Vascular Diseases	BEFREE	7600117		★☆☆☆☆ Found in Text Mining only
Peyronie Disease	Peyronie Disease	BEFREE	24841412, 25532569		★☆☆☆☆ Found in Text Mining only
Pheochromocytoma	Pheochromocytoma	BEFREE	12097293, 20621999, 24390213		★☆☆☆☆ Found in Text Mining only
Pheochromocytoma	Pheochromocytoma	HPO_DG			★☆☆☆☆ Found in Text Mining only
Phyllodes Tumor	Phyllodes Tumor	BEFREE	11920740		★☆☆☆☆ Found in Text Mining only
Pilomatrixoma	Pilomatrixoma	BEFREE	9185911		★☆☆☆☆ Found in Text Mining only
Pituitary Adenoma	Pituitary adenoma	BEFREE	28342098		★☆☆☆☆ Found in Text Mining only
Pituitary Neoplasms	Pituitary Neoplasms	LHGDN	18079202		★☆☆☆☆ Found in Text Mining only
Pituitary Neoplasms	Pituitary neoplasm	Pubtator	22776845, 29565480, 39290194	Associate	★☆☆☆☆ Found in Text Mining only
Pleural effusion disorder	Pleural effusion	HPO_DG			★☆☆☆☆ Found in Text Mining only
Polycythemia	Polycythemia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Pre B-cell acute lymphoblastic leukemia	B-cell Lymphoma	BEFREE	2070085		★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	BEFREE	19633642, 23613410, 27050122		★☆☆☆☆ Found in Text Mining only
Precursor T-Cell Lymphoblastic Leukemia-Lymphoma	Lymphoblastic Leukemia	BEFREE	11781368, 30701029		★☆☆☆☆ Found in Text Mining only
Primary amyloidosis	Amyloidosis	BEFREE	28025584		★☆☆☆☆ Found in Text Mining only
Primary amyloidosis	Amyloidosis	GWASCAT_DG	28025584, 28679651		★☆☆☆☆ Found in Text Mining only
Primary Cutaneous Anaplastic Large Cell Lymphoma	Anaplastic Lymphoma	BEFREE	16614728		★☆☆☆☆ Found in Text Mining only
Primary malignant neoplasm of brain	Brain Neoplasms	CTD_human_DG	20932960, 27935819		★☆☆☆☆ Found in Text Mining only
Prolactinoma	Prolactinoma	BEFREE	22967707, 24373949		★☆☆☆☆ Found in Text Mining only
Proliferative vitreoretinopathy	Proliferative Vitreoretinopathy	BEFREE	26247679		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	10884916, 12455063, 12941814, 14981950, 16267018, 17375037, 17483350, 17606477, 17804732, 19079343, 19269999, 19286570, 19706803, 20395447, 20454608, 20822933, 21212260, 22067725, 23060014, 23354566, 24607787, 24739041, 24820071, 25888980, 26129688, 26497355, 26582866, 28345464, 28617558, 29453900, 29467540, 29571017, 30278884, 30536619, 30621914, 31309555, 9568672, 9591774, 9973108		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Diseases	Prostatic disease	Pubtator	32552908	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Hyperplasia	Prostatic hyperplasia	Pubtator	28216616	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Intraepithelial Neoplasias	Prostatic Neoplasms	BEFREE	19443706		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	10884916, 15314206, 15805119, 17214354, 17375037, 17606477, 18650423, 19079343, 19269999, 19706803, 20028857, 20454608, 20537156, 21205079, 21786090, 22038225, 22266466, 23029264, 23591848, 24098737, 24413182, 24739041, 25622187, 26129688, 26469352, 28617558, 29767250, 30339521, 30763715, 31196962, 32552908, 32566661, 32651179, 33174391, 33522043, 34696665, 34970697, 35204839, 36312753, 37239316, 39574470	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	12455063, 15558026, 16461912, 17606477, 17698033		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	CTD_human_DG	17606477		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	26246306, 9973108		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Psoriasis	Psoriasis	BEFREE	20089081, 22998543, 27864821, 29115643		★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	Pubtator	29115643, 33416099, 36497125	Associate	★☆☆☆☆ Found in Text Mining only
Psoriasis vulgaris	Psoriasis vulgaris	BEFREE	27864821		★☆☆☆☆ Found in Text Mining only
Pulmonary Arterial Hypertension	Pulmonary arterial hypertension	Pubtator	27188753	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary capillary hemangiomatosis	Pulmonary capillary hemangiomatosis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	25708588, 29695901	Stimulate	★☆☆☆☆ Found in Text Mining only
Rectal Carcinoma	Rectal Carcinoma	BEFREE	17398034		★☆☆☆☆ Found in Text Mining only
Recurrent Brain Neoplasm	Brain Neoplasms	CTD_human_DG	20932960, 27935819		★☆☆☆☆ Found in Text Mining only
Refractory anemias	Anemia	BEFREE	11795432		★☆☆☆☆ Found in Text Mining only
Renal carcinoma	Renal Carcinoma	BEFREE	18358634		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	12796377, 15538282, 15991006, 16954163, 18358634, 19246164, 19386349, 21693435, 22155254, 23951092, 25669170, 27766950, 29113352, 30941985, 31748879, 31832810		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	HPO_DG			★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal Diseases	BEFREE	26247679		★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	10190311, 10216470, 10430085, 10493518, 10928172, 11243864, 12040434, 12432268, 12472286, 12589031, 12746453, 14508520, 16510571, 16613540, 17487385, 17546056, 17549378, 17599043, 18406353, 18484097, 19286570, 19676131, 19874578, 2009372, 20460530, 20948989, 21646361, 21654808, 22139542, 22266466, 23022476, 24096545, 24714974, 25738322, 26459309, 28368741, 28551632, 28713162, 28859059, 28869970, 29024602, 29049978, 29059158, 29789630, 29880532, 30191630, 30509085, 30519351, 30718512, 31709901, 7585513, 7812927, 7834618, 7906387, 7972006, 8200932, 8415648, 8548755, 8599583, 8649851, 8729983, 9001420, 9168007, 9192978, 9274525, 9302564, 9462706, 9815783		★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	Pubtator	15976342, 29236940, 35792876, 8052667	Associate	★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	LHGDN	17616526		★☆☆☆☆ Found in Text Mining only
RETINOSCHISIS 1, X-LINKED, JUVENILE	Retinoschisis, X-Linked	BEFREE	12040434		★☆☆☆☆ Found in Text Mining only
Rhabdoid Tumor	Rhabdoid tumor	Pubtator	12138206, 17376508, 20212451, 32558936	Associate	★☆☆☆☆ Found in Text Mining only
Rhabdoid Tumor	Rhabdoid Tumor	LHGDN	15981100		★☆☆☆☆ Found in Text Mining only
Rhabdoid Tumor	Rhabdoid Tumor	BEFREE	20179200, 21666498, 25751590		★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	BEFREE	15342383, 24088803, 26363896		★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	Pubtator	32703497	Associate	★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	11795432, 15736039, 18830906, 28987940		★☆☆☆☆ Found in Text Mining only
Salivary Gland Neoplasms	Salivary gland neoplasm	CTD_human_DG	16762588		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Salivary Gland Neoplasms	Salivary gland neoplasms	Pubtator	26247885	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Sarcoma	BEFREE	11341347, 14977835, 16733209, 19898427, 23599159, 24019980, 7640224, 8318919, 9582521		★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	Pubtator	11958662, 15578074, 19898427, 20186824, 24019980, 26943575, 32514165	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	LHGDN	15578074		★☆☆☆☆ Found in Text Mining only
Sarcoma Clear Cell	Sarcoma	Pubtator	30736802, 35147974	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma Endometrial Stromal	Endometrial stromal sarcoma	Pubtator	19898427	Stimulate	★☆☆☆☆ Found in Text Mining only
Sarcoma Endometrial Stromal	Endometrial stromal sarcoma	Pubtator	22982899, 24186140, 25244606, 31607703	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma Ewing	Sarcoma	Pubtator	17384216, 25015333, 30736802, 36849756	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma Kaposi	Sarcoma	Pubtator	10645225, 23818101	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma Synovial	Synovial sarcoma	Pubtator	10702413, 16740029, 26415226, 27334220	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma, Epithelioid	Sarcoma	BEFREE	11048803, 15578074, 24585572		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	10490696, 18322470, 27130439		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	PSYGENET_DG	18322470		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Scleroderma Systemic	Systemic sclerosis	Pubtator	31156645	Associate	★☆☆☆☆ Found in Text Mining only
Secondary malignant neoplasm of colon and/or rectum	Colorectal Neoplasms	BEFREE	15908664, 20485284		★☆☆☆☆ Found in Text Mining only
Senile Plaques	Senile Plaques	BEFREE	15175081		★☆☆☆☆ Found in Text Mining only
Sensorineural Hearing Loss (disorder)	Hearing Loss	HPO_DG			★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	30052667		★☆☆☆☆ Found in Text Mining only
Severe Combined Immunodeficiency	Severe combined immunodeficiency disease	BEFREE	11291051		★☆☆☆☆ Found in Text Mining only
Sex Differentiation Disorders	Sex Differentiation Disorders	BEFREE	20684002		★☆☆☆☆ Found in Text Mining only
Sezary Syndrome	Sezary Syndrome	BEFREE	16614728		★☆☆☆☆ Found in Text Mining only
Sezary Syndrome	Sezary syndrome	Pubtator	16614728	Stimulate	★☆☆☆☆ Found in Text Mining only
Sezary Syndrome	Sezary syndrome	Pubtator	8573535	Associate	★☆☆☆☆ Found in Text Mining only
Sick Sinus Syndrome	Sick sinus syndrome	Pubtator	37951919	Associate	★☆☆☆☆ Found in Text Mining only
Sinus histiocytosis	Sinus Histiocytosis	BEFREE	30323237, 31172509		★☆☆☆☆ Found in Text Mining only
Skin carcinoma	Skin Carcinoma	BEFREE	15723720		★☆☆☆☆ Found in Text Mining only
Skin Diseases	Skin disease	Pubtator	20496072, 37863651	Associate	★☆☆☆☆ Found in Text Mining only
Skin lesion	Skin Lesion	BEFREE	20496072		★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Skin Neoplasms	BEFREE	10029404, 20940395, 21132436, 9716400		★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Skin neoplasm	Pubtator	21497295	Associate	★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	22222631, 26246306, 29739297, 30086699, 31188872, 7834618		★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	11395375, 24978188, 8052667, 9600126	Associate	★☆☆☆☆ Found in Text Mining only
Small Lymphocytic Lymphoma	Lymphocytic Leukemia	BEFREE	1661167, 2078513, 2242428, 3259659, 7612496, 8123854, 9556424		★☆☆☆☆ Found in Text Mining only
Small Lymphocytic Lymphoma	Lymphocytic Leukemia	ORPHANET_DG			★☆☆☆☆ Found in Text Mining only
Solitary fibrous tumor	Solitary fibrous tumor	LHGDN	17090192		★☆☆☆☆ Found in Text Mining only
Spastic paraplegia 11 autosomal recessive	Spastic paraplegia	Pubtator	12237776	Associate	★☆☆☆☆ Found in Text Mining only
Spermatocele	Spermatocele	HPO_DG			★☆☆☆☆ Found in Text Mining only
Spinal hemangioblastoma	Spinal hemangioblastoma	HPO_DG			★☆☆☆☆ Found in Text Mining only
SPONDYLOCARPOTARSAL SYNOSTOSIS SYNDROME	Spondylocarpotarsal Synostosis Syndrome	BEFREE	24061522		★☆☆☆☆ Found in Text Mining only
Sporadic Breast Carcinoma	Breast Carcinoma	BEFREE	15351094		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	10092061, 10344760, 10492034, 10498401, 10519399, 10690551, 10766394, 10928172, 11287281, 11352854, 12167432, 12507294, 12579289, 12694349, 12792768, 12798405, 12807740, 15063389, 15484403, 15695117, 15723720, 16153639, 16172916, 16235239, 16644573, 17139501, 17549378, 17893905, 18251939, 18548202, 19679297, 21042715, 21254295, 21537090, 2170896, 21726982, 22296356, 22835384, 23494454, 24391010, 24403468, 24675814, 2476705, 25645517, 25869879, 26030731, 26055143, 27447534, 27498289, 27973759, 28052061, 28329421, 28369091, 29516928, 30321764, 30663412, 7866635, 7867006, 7942638, 8062283, 8398339, 8529470, 9042789, 9070488, 9192552, 9310139, 9333020, 9591537, 9796972, 9813719, 9815619, 9816104, 9816282, 9829720		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	LHGDN	12067972, 12607604, 12694349, 16172916, 16820873, 17060721, 17198740, 17549378, 17695500, 18251939, 18514338, 18548202, 18787961, 18942709		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	CTD_human_DG	26432044		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	10526265, 10568815, 10928132, 11295092, 11570573, 12202983, 12673692, 14966901, 15672286, 16053486, 16827140, 17016592, 17308098, 17309796, 17498553, 17912028, 18704459, 19207549, 19857041, 20389301, 21268129, 21537837, 22150974, 22761904, 23657608, 24391010, 25160749, 25801820, 26833333, 27145270, 27721245, 28123566, 28123574, 28365443, 28578693, 28599478, 28602785, 28818096, 29107111, 30210237, 30484863, 30532557, 30779917, 30887517, 30899002, 31720087, 8625145, 8781742, 9815619, 9816282		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	CTD_human_DG	25151357		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	10474686, 11696452, 15846092, 16050486, 16265665, 17045795, 17505605, 17893905, 18413827, 21042715, 21537090, 21890746, 21989926, 22065993, 22143720, 22296356, 22336657, 22629227, 22853846, 22901182, 23451060, 23451093, 23515614, 23566410, 23672832, 23692432, 23696923, 23730900, 23749487, 24278325, 24470282, 25022375, 25536600, 25591548, 25645517, 25869879, 26175310, 26194878, 26449430, 26515287, 27039754, 27329726, 27507850, 27793210, 28107179, 28435450, 28671055, 28859688, 29053175, 29443735, 29516928, 29747488, 29785357, 30138436, 30189895, 30548484, 30563911, 30949979, 31427478, 31427592, 31683463, 31878037, 31951319, 31983161, 32065407, 32102514, 33840043, 34409799, 34933671, 35216636, 35389764, 35488777, 36849369, 37481637, 37930255, 39432990, 8529470, 9310139	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	24982332, 25437003	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Squamous cell carcinoma of lung	Lung carcinoma	BEFREE	2170896, 26943773, 27498289, 28151013		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of mouth	Oral cavity carcinoma	BEFREE	16265665		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of oropharynx	Oropharyngeal carcinoma	BEFREE	14981901, 28107179		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of skin	Skin carcinoma	BEFREE	16885339, 17198740, 22998543, 31611744		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	10070974, 10376532, 10899669, 10955801, 11287281, 11404608, 11470749, 11504311, 11696452, 11743641, 12067972, 12148857, 12193474, 12478543, 12738730, 14586645, 14729608, 14981992, 15063391, 15592503, 17065789, 17909038, 18413827, 19787783, 20149059, 20969630, 21890746, 21989926, 22213296, 22812184, 23494454, 23730900, 24473065, 24982332, 25437003, 29464035, 30138436, 30871913, 31184805, 31574205, 7590696, 7867006, 7927946, 8004570, 8529470, 8902564, 9010112, 9310139, 9421351, 9504605, 9796972		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	CTD_human_DG	26909611, 29464035		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of tongue	Tongue carcinoma	BEFREE	11566495, 12167432, 22296356, 23451060		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of vulva	Carcinoma Of Vulva	BEFREE	7812927		★☆☆☆☆ Found in Text Mining only
Squamous Cell Neoplasms	Neoplasm	LHGDN	15709184		★☆☆☆☆ Found in Text Mining only
Squamous Cell Neoplasms	Neoplasm	BEFREE	1682919		★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	12917338, 31034519		★☆☆☆☆ Found in Text Mining only
Steroid-sensitive nephrotic syndrome	Steroid-Sensitive Nephrotic Syndrome	BEFREE	18343955		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	11349065, 15378768, 17217616, 17447856, 18609126, 20397048, 23194503, 23383271, 24100731, 24618206, 24623314, 25202078, 25337233, 25338835, 25586465, 25649416, 25882375, 26791264, 27071318, 27623072, 27798882, 28569779, 28718369, 29104635, 29495973, 30714150, 30974047, 31249448		★☆☆☆☆ Found in Text Mining only
Stomach Diseases	Stomach disease	Pubtator	20525401	Stimulate	★☆☆☆☆ Found in Text Mining only
Stomach Diseases	Stomach disease	Pubtator	28401064	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	11059220, 11349065, 11676861, 12606305, 12632490, 15378768, 16127741, 16163549, 16586549, 16769709, 18293492, 19448398, 19749785, 19938192, 20525401, 20929525, 21777278, 23072573, 23106939, 23383271, 23745024, 23824821, 25337233, 25400723, 25649416, 25743022, 25882375, 26211905, 26352175, 27864121, 28388558, 28596683, 28618940, 28718369, 28832082, 29209988, 29495973, 29866946, 30479464, 30624523, 30810117, 30974047, 31048690, 31249448, 31982864, 32020871, 32373959, 33262572, 33605558, 34110086, 34719326, 36438913, 37340423, 37635596, 37863651, 40082221, 40138292, 9811181	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stomach Neoplasms	Stomach Neoplasms	BEFREE	16490596		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stomach Neoplasms	Stomach Neoplasms	LHGDN	16490596, 17393422, 17447856, 18437417, 18609126		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stomach Neoplasms	Stomach Neoplasms	CTD_human_DG	21628965		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stomatitis	Stomatitis	BEFREE	28445979		★☆☆☆☆ Found in Text Mining only
Stomatitis	Stomatitis	Pubtator	28445979	Associate	★☆☆☆☆ Found in Text Mining only
synovial sarcoma	Synovial sarcoma	BEFREE	12097301, 16733209, 16740029, 17074682, 19602458		★☆☆☆☆ Found in Text Mining only
T-Cell Lymphoma	T-Cell Lymphoma	BEFREE	27874957		★☆☆☆☆ Found in Text Mining only
TARSAL-CARPAL COALITION SYNDROME	Tarsal-Carpal Coalition Syndrome	BEFREE	9192983		★☆☆☆☆ Found in Text Mining only
Testicular Germ Cell Tumor	Testicular Germ Cell Tumor	BEFREE	20395447		★☆☆☆☆ Found in Text Mining only
Testicular Germ Cell Tumor	Testicular germ cell tumor	Pubtator	20395447	Associate	★☆☆☆☆ Found in Text Mining only
Thrombocythemia, Essential	Thrombocythemia	LHGDN	19129688		★☆☆☆☆ Found in Text Mining only
Thymoma	Thymoma	BEFREE	9398039		★☆☆☆☆ Found in Text Mining only
Thymus Hyperplasia	Thymus Hyperplasia	BEFREE	8755527		★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	15796211, 18925698, 19223551, 20543822, 25227811, 26323637, 26863116, 30885146, 32198408	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	37951919	Stimulate	★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	11041450, 11932322, 20372070, 29269566, 30428594, 31304680, 9626345, 9666346		★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	CTD_human_DG	23811263		★☆☆☆☆ Found in Text Mining only
Thyroid Carcinoma Anaplastic	Thyroid cancer	Pubtator	31077090	Inhibit	★☆☆☆☆ Found in Text Mining only
Thyroid Carcinoma Anaplastic	Thyroid cancer	Pubtator	35001007	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Diseases	Thyroid disease	Pubtator	12237874	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Gland Follicular Adenoma	Thyroid Gland Follicular Adenoma	CTD_human_DG	23811263		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	11288983, 15095272, 20372070, 25907675, 27440272, 29269566, 30428594, 31304680, 9626345, 9666346		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	LHGDN	17188136, 17693985, 17906980, 17916995, 18753363		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	CTD_human_DG	23811263		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	19443989, 25244400, 25907675, 26431489, 30272326, 30885146, 32198408, 33179076	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid Nodule	Thyroid Nodule	BEFREE	30885146		★☆☆☆☆ Found in Text Mining only
Thyroiditis	Thyroiditis	Pubtator	19787802	Associate	★☆☆☆☆ Found in Text Mining only
Tongue Neoplasms	Tongue Neoplasms	BEFREE	20043093		★☆☆☆☆ Found in Text Mining only
Tongue Neoplasms	Tongue cancer	Pubtator	22296356, 25645517, 28939077	Associate	★☆☆☆☆ Found in Text Mining only
Transitional cell carcinoma of bladder	Bladder carcinoma	BEFREE	11286838, 24268029, 9720584		★☆☆☆☆ Found in Text Mining only
Triglyceride storage disease with ichthyosis	Triglyceride Storage Disease With Ichthyosis	BEFREE	22350005		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	24096545, 25056374, 26799586, 27208794, 28075450, 28797035, 28952212, 29288363, 31591311, 31742868, 32652519, 33824311, 33911067, 35236318, 37378935, 37885030, 38525814, 38623967	Associate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	26431674, 27956520, 28036267, 28437471, 28911002, 28952212, 31591311		★☆☆☆☆ Found in Text Mining only
Tuberous Sclerosis	Tuberous Sclerosis	BEFREE	21693435		★☆☆☆☆ Found in Text Mining only
TUBEROUS SCLEROSIS 2 (disorder)	Tuberous Sclerosis	BEFREE	21693435, 21813464		★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	12827612, 17445872		★☆☆☆☆ Found in Text Mining only
Undifferentiated carcinoma	Carcinoma	CTD_human_DG	12376462, 14522882, 16316942, 17173897		★☆☆☆☆ Found in Text Mining only
Unipolar Depression	Mental Depression	BEFREE	18246526		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Unipolar Depression	Mental Depression	PSYGENET_DG	18246526		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ureteral Neoplasms	Ureteral Neoplasms	BEFREE	21498736		★☆☆☆☆ Found in Text Mining only
Urinary Bladder Diseases	Urinary bladder diseases	Pubtator	30352907	Associate	★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	10376969, 11144504, 12237776, 15160340, 15590562, 16804724, 18310301, 18361427, 19682434, 20540739, 23201130, 23887292, 23991964, 24324055, 25556372, 25888950, 26198047, 27338044, 27831653, 27835695, 27862976, 28488128, 29480994, 29532898, 30279572, 31769229, 33656636, 36316768, 40083696, 9192983, 9738978	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	28285559	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Urologic Neoplasms	Urologic Neoplasms	CTD_human_DG	21040761		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Urothelial Carcinoma	Urothelial Carcinoma	BEFREE	18640142, 21789902, 27918099		★☆☆☆☆ Found in Text Mining only
Uterine Cancer	Endometrial Cancer	BEFREE	14666699		★☆☆☆☆ Found in Text Mining only
Uterine Cervical Dysplasia	Uterine disease	Pubtator	12610511, 33954190	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasm	Uterine cervix neoplasm	CTD_human_DG	26432044		★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	15856299, 20105337, 20680537, 23301094, 23803076, 25520193, 26631043, 27364926, 27732565, 28627709, 29989647, 30903019, 31244286, 31284780, 31337953, 32271410, 32373949, 38555994	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine Diseases	Uterine polyp	Pubtator	18691378	Stimulate	★☆☆☆☆ Found in Text Mining only
Uterine Diseases	Uterine polyp	Pubtator	23947899	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Fibroids	Uterine Fibroids	BEFREE	18182398, 24130091, 29082249		★☆☆☆☆ Found in Text Mining only
Uterine Neoplasms	Uterine neoplasm	Pubtator	35575789	Associate	★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal melanoma	Pubtator	10732752, 22653968, 24781943, 9828785	Associate	★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal Melanoma	BEFREE	22653968		★☆☆☆☆ Found in Text Mining only
Van der Woude syndrome	Van Der Woude Syndrome	BEFREE	27174173		★☆☆☆☆ Found in Text Mining only
Varicocele	Varicocele	BEFREE	29441600		★☆☆☆☆ Found in Text Mining only
VATER association	Vacterl association	Pubtator	14645696	Associate	★☆☆☆☆ Found in Text Mining only
Von Hippel-Lindau Syndrome	Von Hippel-Lindau Syndrome	BEFREE	12097293, 15991006, 16187023		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Von Hippel-Lindau Syndrome	Von Hippel-Lindau Syndrome	LHGDN	12097293		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Von Hippel-Lindau Syndrome	Von Hippel-Lindau Syndrome	CTD_human_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Von Hippel-Lindau Syndrome	Von Hippel-Lindau Syndrome	GENOMICS_ENGLAND_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Waldenstrom Macroglobulinemia	Waldenstrom`s Macroglobulinemia	BEFREE	8204891		★☆☆☆☆ Found in Text Mining only
Waldenstrom Macroglobulinemia	Waldenstrom macroglobulinemia	Pubtator	9548443	Associate	★☆☆☆☆ Found in Text Mining only
Well Differentiated Oligodendroglioma	Oligodendroglioma	BEFREE	29489901		★☆☆☆☆ Found in Text Mining only
Wilms Tumor	Wilms tumor	Pubtator	30736802, 35147974	Associate	★☆☆☆☆ Found in Text Mining only
XERODERMA PIGMENTOSUM, COMPLEMENTATION GROUP C	Xeroderma Pigmentosum	BEFREE	14688016, 24264314		★☆☆☆☆ Found in Text Mining only
Xeroderma Pigmentosum, Complementation Group D	Xeroderma Pigmentosum	BEFREE	30146633		★☆☆☆☆ Found in Text Mining only