Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	5947
Gene name	Retinol binding protein 1
Gene symbol	RBP1
Synonyms (NCBI Gene)	CRABP-ICRBPCRBP1CRBPIRBPChCRBP1
Chromosome	3
Chromosome location	3q23
Summary	This gene encodes the carrier protein involved in the transport of retinol (vitamin A alcohol) from the liver storage site to peripheral tissue. Vitamin A is a fat-soluble vitamin necessary for growth, reproduction, differentiation of epithelial tissues,

211

Show/Hide all (211)

miRTarBase ID	miRNA	Experiments	Reference
MIRT018800	hsa-miR-335-5p	Microarray	18185580
MIRT1297332	hsa-miR-1273e	CLIP-seq
MIRT1297333	hsa-miR-1287	CLIP-seq
MIRT1297334	hsa-miR-134	CLIP-seq
MIRT1297335	hsa-miR-142-3p	CLIP-seq
MIRT1297336	hsa-miR-155	CLIP-seq
MIRT1297337	hsa-miR-1827	CLIP-seq
MIRT1297338	hsa-miR-2054	CLIP-seq
MIRT1297339	hsa-miR-24	CLIP-seq
MIRT1297340	hsa-miR-2964a-3p	CLIP-seq
MIRT1297341	hsa-miR-302f	CLIP-seq
MIRT1297342	hsa-miR-3118	CLIP-seq
MIRT1297343	hsa-miR-3135b	CLIP-seq
MIRT1297344	hsa-miR-338-3p	CLIP-seq
MIRT1297345	hsa-miR-342-3p	CLIP-seq
MIRT1297346	hsa-miR-3677-5p	CLIP-seq
MIRT1297347	hsa-miR-3689a-3p	CLIP-seq
MIRT1297348	hsa-miR-3689c	CLIP-seq
MIRT1297349	hsa-miR-3929	CLIP-seq
MIRT1297350	hsa-miR-4270	CLIP-seq
MIRT1297351	hsa-miR-4284	CLIP-seq
MIRT1297352	hsa-miR-4292	CLIP-seq
MIRT1297353	hsa-miR-4308	CLIP-seq
MIRT1297354	hsa-miR-4310	CLIP-seq
MIRT1297355	hsa-miR-4419b	CLIP-seq
MIRT1297356	hsa-miR-4441	CLIP-seq
MIRT1297357	hsa-miR-4456	CLIP-seq
MIRT1297358	hsa-miR-4478	CLIP-seq
MIRT1297359	hsa-miR-4649-3p	CLIP-seq
MIRT1297360	hsa-miR-4722-5p	CLIP-seq
MIRT1297361	hsa-miR-4728-5p	CLIP-seq
MIRT1297362	hsa-miR-4747-5p	CLIP-seq
MIRT1297363	hsa-miR-4768-3p	CLIP-seq
MIRT1297364	hsa-miR-485-5p	CLIP-seq
MIRT1297365	hsa-miR-541	CLIP-seq
MIRT1297366	hsa-miR-654-5p	CLIP-seq
MIRT1297367	hsa-miR-890	CLIP-seq
MIRT1297368	hsa-miR-940	CLIP-seq
MIRT1297369	hsa-miR-943	CLIP-seq
MIRT1297333	hsa-miR-1287	CLIP-seq
MIRT1297336	hsa-miR-155	CLIP-seq
MIRT1297343	hsa-miR-3135b	CLIP-seq
MIRT1297332	hsa-miR-1273e	CLIP-seq
MIRT1297333	hsa-miR-1287	CLIP-seq
MIRT1297334	hsa-miR-134	CLIP-seq
MIRT1297337	hsa-miR-1827	CLIP-seq
MIRT1297340	hsa-miR-2964a-3p	CLIP-seq
MIRT1297341	hsa-miR-302f	CLIP-seq
MIRT1297342	hsa-miR-3118	CLIP-seq
MIRT2088379	hsa-miR-3122	CLIP-seq
MIRT1297343	hsa-miR-3135b	CLIP-seq
MIRT2088380	hsa-miR-3164	CLIP-seq
MIRT2088381	hsa-miR-3606	CLIP-seq
MIRT2088382	hsa-miR-3672	CLIP-seq
MIRT1297347	hsa-miR-3689a-3p	CLIP-seq
MIRT1297348	hsa-miR-3689c	CLIP-seq
MIRT2088383	hsa-miR-3913-5p	CLIP-seq
MIRT1297349	hsa-miR-3929	CLIP-seq
MIRT1297350	hsa-miR-4270	CLIP-seq
MIRT1297352	hsa-miR-4292	CLIP-seq
MIRT2088384	hsa-miR-4293	CLIP-seq
MIRT1297353	hsa-miR-4308	CLIP-seq
MIRT1297355	hsa-miR-4419b	CLIP-seq
MIRT1297356	hsa-miR-4441	CLIP-seq
MIRT1297357	hsa-miR-4456	CLIP-seq
MIRT1297358	hsa-miR-4478	CLIP-seq
MIRT1297359	hsa-miR-4649-3p	CLIP-seq
MIRT1297360	hsa-miR-4722-5p	CLIP-seq
MIRT1297361	hsa-miR-4728-5p	CLIP-seq
MIRT1297362	hsa-miR-4747-5p	CLIP-seq
MIRT1297363	hsa-miR-4768-3p	CLIP-seq
MIRT2088385	hsa-miR-4786-5p	CLIP-seq
MIRT1297364	hsa-miR-485-5p	CLIP-seq
MIRT1297365	hsa-miR-541	CLIP-seq
MIRT1297366	hsa-miR-654-5p	CLIP-seq
MIRT2088386	hsa-miR-769-5p	CLIP-seq
MIRT1297367	hsa-miR-890	CLIP-seq
MIRT1297368	hsa-miR-940	CLIP-seq
MIRT1297369	hsa-miR-943	CLIP-seq
MIRT1297332	hsa-miR-1273e	CLIP-seq
MIRT1297335	hsa-miR-142-3p	CLIP-seq
MIRT1297337	hsa-miR-1827	CLIP-seq
MIRT1297338	hsa-miR-2054	CLIP-seq
MIRT1297339	hsa-miR-24	CLIP-seq
MIRT2313308	hsa-miR-2467-3p	CLIP-seq
MIRT1297340	hsa-miR-2964a-3p	CLIP-seq
MIRT1297341	hsa-miR-302f	CLIP-seq
MIRT2088379	hsa-miR-3122	CLIP-seq
MIRT2313309	hsa-miR-3134	CLIP-seq
MIRT1297344	hsa-miR-338-3p	CLIP-seq
MIRT1297345	hsa-miR-342-3p	CLIP-seq
MIRT2313310	hsa-miR-3612	CLIP-seq
MIRT1297346	hsa-miR-3677-5p	CLIP-seq
MIRT1297347	hsa-miR-3689a-3p	CLIP-seq
MIRT1297348	hsa-miR-3689c	CLIP-seq
MIRT2088383	hsa-miR-3913-5p	CLIP-seq
MIRT1297349	hsa-miR-3929	CLIP-seq
MIRT1297350	hsa-miR-4270	CLIP-seq
MIRT1297351	hsa-miR-4284	CLIP-seq
MIRT1297352	hsa-miR-4292	CLIP-seq
MIRT1297353	hsa-miR-4308	CLIP-seq
MIRT1297354	hsa-miR-4310	CLIP-seq
MIRT1297355	hsa-miR-4419b	CLIP-seq
MIRT1297356	hsa-miR-4441	CLIP-seq
MIRT1297357	hsa-miR-4456	CLIP-seq
MIRT1297358	hsa-miR-4478	CLIP-seq
MIRT1297359	hsa-miR-4649-3p	CLIP-seq
MIRT1297360	hsa-miR-4722-5p	CLIP-seq
MIRT1297361	hsa-miR-4728-5p	CLIP-seq
MIRT1297362	hsa-miR-4747-5p	CLIP-seq
MIRT1297363	hsa-miR-4768-3p	CLIP-seq
MIRT1297364	hsa-miR-485-5p	CLIP-seq
MIRT1297365	hsa-miR-541	CLIP-seq
MIRT2313311	hsa-miR-650	CLIP-seq
MIRT1297366	hsa-miR-654-5p	CLIP-seq
MIRT1297367	hsa-miR-890	CLIP-seq
MIRT1297368	hsa-miR-940	CLIP-seq
MIRT1297333	hsa-miR-1287	CLIP-seq
MIRT1297338	hsa-miR-2054	CLIP-seq
MIRT2088379	hsa-miR-3122	CLIP-seq
MIRT1297343	hsa-miR-3135b	CLIP-seq
MIRT1297344	hsa-miR-338-3p	CLIP-seq
MIRT1297347	hsa-miR-3689a-3p	CLIP-seq
MIRT1297348	hsa-miR-3689c	CLIP-seq
MIRT2088383	hsa-miR-3913-5p	CLIP-seq
MIRT1297354	hsa-miR-4310	CLIP-seq
MIRT1297361	hsa-miR-4728-5p	CLIP-seq
MIRT2432480	hsa-miR-3123	CLIP-seq
MIRT1297344	hsa-miR-338-3p	CLIP-seq
MIRT2432481	hsa-miR-3919	CLIP-seq
MIRT2432482	hsa-miR-4530	CLIP-seq
MIRT2432483	hsa-miR-4790-3p	CLIP-seq
MIRT2432484	hsa-miR-922	CLIP-seq
MIRT2432480	hsa-miR-3123	CLIP-seq
MIRT1297344	hsa-miR-338-3p	CLIP-seq
MIRT2432481	hsa-miR-3919	CLIP-seq
MIRT2432482	hsa-miR-4530	CLIP-seq
MIRT2432483	hsa-miR-4790-3p	CLIP-seq
MIRT2432484	hsa-miR-922	CLIP-seq
MIRT1297338	hsa-miR-2054	CLIP-seq
MIRT2088379	hsa-miR-3122	CLIP-seq
MIRT1297344	hsa-miR-338-3p	CLIP-seq
MIRT1297347	hsa-miR-3689a-3p	CLIP-seq
MIRT1297348	hsa-miR-3689c	CLIP-seq
MIRT2088383	hsa-miR-3913-5p	CLIP-seq
MIRT1297349	hsa-miR-3929	CLIP-seq
MIRT1297354	hsa-miR-4310	CLIP-seq
MIRT1297355	hsa-miR-4419b	CLIP-seq
MIRT1297358	hsa-miR-4478	CLIP-seq
MIRT1297361	hsa-miR-4728-5p	CLIP-seq
MIRT1297364	hsa-miR-485-5p	CLIP-seq
MIRT2609570	hsa-miR-10a	CLIP-seq
MIRT2609571	hsa-miR-10b	CLIP-seq
MIRT1297332	hsa-miR-1273e	CLIP-seq
MIRT1297334	hsa-miR-134	CLIP-seq
MIRT1297337	hsa-miR-1827	CLIP-seq
MIRT1297338	hsa-miR-2054	CLIP-seq
MIRT1297340	hsa-miR-2964a-3p	CLIP-seq
MIRT1297341	hsa-miR-302f	CLIP-seq
MIRT1297342	hsa-miR-3118	CLIP-seq
MIRT2088379	hsa-miR-3122	CLIP-seq
MIRT2088380	hsa-miR-3164	CLIP-seq
MIRT1297344	hsa-miR-338-3p	CLIP-seq
MIRT2609572	hsa-miR-339-5p	CLIP-seq
MIRT1297347	hsa-miR-3689a-3p	CLIP-seq
MIRT1297348	hsa-miR-3689c	CLIP-seq
MIRT2088383	hsa-miR-3913-5p	CLIP-seq
MIRT1297349	hsa-miR-3929	CLIP-seq
MIRT1297354	hsa-miR-4310	CLIP-seq
MIRT1297355	hsa-miR-4419b	CLIP-seq
MIRT2609573	hsa-miR-4421	CLIP-seq
MIRT1297358	hsa-miR-4478	CLIP-seq
MIRT1297359	hsa-miR-4649-3p	CLIP-seq
MIRT2609574	hsa-miR-4684-5p	CLIP-seq
MIRT1297360	hsa-miR-4722-5p	CLIP-seq
MIRT1297361	hsa-miR-4728-5p	CLIP-seq
MIRT1297363	hsa-miR-4768-3p	CLIP-seq
MIRT1297364	hsa-miR-485-5p	CLIP-seq
MIRT2609575	hsa-miR-593	CLIP-seq
MIRT1297367	hsa-miR-890	CLIP-seq
MIRT1297368	hsa-miR-940	CLIP-seq
MIRT1297369	hsa-miR-943	CLIP-seq
MIRT2609570	hsa-miR-10a	CLIP-seq
MIRT2609571	hsa-miR-10b	CLIP-seq
MIRT1297332	hsa-miR-1273e	CLIP-seq
MIRT1297334	hsa-miR-134	CLIP-seq
MIRT1297337	hsa-miR-1827	CLIP-seq
MIRT1297338	hsa-miR-2054	CLIP-seq
MIRT1297340	hsa-miR-2964a-3p	CLIP-seq
MIRT1297341	hsa-miR-302f	CLIP-seq
MIRT1297342	hsa-miR-3118	CLIP-seq
MIRT2088380	hsa-miR-3164	CLIP-seq
MIRT1297344	hsa-miR-338-3p	CLIP-seq
MIRT2609572	hsa-miR-339-5p	CLIP-seq
MIRT1297347	hsa-miR-3689a-3p	CLIP-seq
MIRT1297348	hsa-miR-3689c	CLIP-seq
MIRT1297349	hsa-miR-3929	CLIP-seq
MIRT1297354	hsa-miR-4310	CLIP-seq
MIRT1297355	hsa-miR-4419b	CLIP-seq
MIRT2609573	hsa-miR-4421	CLIP-seq
MIRT1297358	hsa-miR-4478	CLIP-seq
MIRT1297359	hsa-miR-4649-3p	CLIP-seq
MIRT2609574	hsa-miR-4684-5p	CLIP-seq
MIRT1297360	hsa-miR-4722-5p	CLIP-seq
MIRT1297361	hsa-miR-4728-5p	CLIP-seq
MIRT1297363	hsa-miR-4768-3p	CLIP-seq
MIRT1297364	hsa-miR-485-5p	CLIP-seq
MIRT2609575	hsa-miR-593	CLIP-seq
MIRT1297367	hsa-miR-890	CLIP-seq
MIRT1297368	hsa-miR-940	CLIP-seq
MIRT1297369	hsa-miR-943	CLIP-seq

Show/Hide all (23)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002138	Process	Retinoic acid biosynthetic process	IEA
GO:0005501	Function	Retinoid binding	TAS	3472205
GO:0005504	Function	Fatty acid binding	IBA
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005634	Component	Nucleus	IBA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005737	Component	Cytoplasm	IEA
GO:0005811	Component	Lipid droplet	IDA	15632377
GO:0005811	Component	Lipid droplet	IEA
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0006776	Process	Vitamin A metabolic process	IEA
GO:0006776	Process	Vitamin A metabolic process	IMP	15632377
GO:0006776	Process	Vitamin A metabolic process	TAS	3472205
GO:0008289	Function	Lipid binding	IEA
GO:0015908	Process	Fatty acid transport	IBA
GO:0016918	Function	Retinal binding	IEA
GO:0019841	Function	Retinol binding	IEA
GO:0055088	Process	Lipid homeostasis	IMP	15632377
GO:1904768	Function	All-trans-retinol binding	IBA
GO:1904768	Function	All-trans-retinol binding	IDA	28057518

MIM	HGNC	e!Ensembl
180260	9919	ENSG00000114115

P09455

Protein name

Retinol-binding protein 1 (Cellular retinol-binding protein) (CRBP) (Cellular retinol-binding protein I) (CRBP-I)

Protein function

Cytoplasmic retinol-binding protein (PubMed:22665496, PubMed:26900151, PubMed:28057518). Accepts retinol from the transport protein STRA6, and thereby contributes to retinol uptake, storage and retinoid homeostasis (PubMed:15632377, PubMed:22665

PDB

5H8T , 5H9A , 5HA1 , 5HBS , 5LJB , 5LJC , 5LJD , 5LJE , 5LJG , 5LJH , 5LJK , 6E5L , 6E5T , 6E6M , 8GD2 , 8GDM , 8GEM , 8GEU , 8GEV , 8GEY

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00061	Lipocalin	6 → 134	Lipocalin / cytosolic fatty-acid binding protein family	Domain

Tissue specificity

TISSUE SPECIFICITY: Detected in nearly all the tissues with higher expression in adult ovary, pancreas, pituitary gland and adrenal gland, and fetal liver. {ECO:0000269|PubMed:11274389}.

Sequence

MPVDFTGYWKMLVNENFEEYLRALDVNVALRKIANLLKPDKEIVQDGDHMIIRTLSTFRN
YIMDFQVGKEFEEDLTGIDDRKCMTTVSWDGDKLQCVQKGEKEGRGWTQWIEGDELHLEM
RVEGVVCKQVFKKVQ

Sequence length

135

Interactions

View interactions

	Reactome
			Retinoid cycle disease events The canonical retinoid cycle in rods (twilight vision) Retinoid metabolism and transport

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (7)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
CARCINOMA	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARCINOMA, BASAL CELL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Leber congenital amaurosis	Uncertain significance	ClinVar Disgenet	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Lung cancer	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STOMACH NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (101)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma	Adenocarcinoma	BEFREE	15280411		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alopecia	Alopecia	BEFREE	30556317		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alopecia Areata	Alopecia Areata	BEFREE	30556317		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anaplastic carcinoma	Anaplastic Carcinoma	CTD_human_DG	12376462		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anaplastic carcinoma	Anaplastic Carcinoma	BEFREE	23639973		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Psoriatic	Psoriatic arthritis	Pubtator	1335015	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atypical Endometrial Hyperplasia	Endometrial Hyperplasia	BEFREE	16575402		★★★★★ ★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	BEFREE	18831746		★★★★★ ★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	Pubtator	18831746	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	21042705		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	10716965, 11704871, 17079450, 20716965, 22220202, 29720147, 9368510		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	20716965, 25287138	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	29720147	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	35269414	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cancer of Nasopharynx	Nasopharyngeal Cancer	BEFREE	25879031		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	CTD_human_DG	12376462		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinoma	Carcinoma	BEFREE	12384555, 15623627, 23639973, 24982334, 7657389		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Carcinoma of bladder	Bladder carcinoma	BEFREE	21042705		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of larynx	Laryngeal carcinoma	BEFREE	22049223		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	1335015	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Endometrioid	Endometrioid cancer	BEFREE	16575402		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	12631600, 19110304, 24982334, 29720147		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Spindle-Cell	Carcinoma	CTD_human_DG	12376462		★★★★★ ★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	24040446		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	24040446		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	17550320	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cirrhosis	Cirrhosis	BEFREE	15094224		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	36518255	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	16254461		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	9368510		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial adenocarcinoma	Endometrial Adenocarcinoma	BEFREE	7657389		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	16575402		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Hyperplasia	Endometrial Hyperplasia	BEFREE	16575402		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Hyperplasia	Endometrial hyperplasia	Pubtator	16575402	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	25143356		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	16128742	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibroid Tumor	Leiomyoma	BEFREE	17276435, 18343808		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	28348420		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastrointestinal Neoplasms	Gastrointestinal neoplasm	Pubtator	32883271	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma, Primary Open Angle	Glaucoma	BEFREE	22171153		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	22945948, 40348204	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	22945948		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	22945948	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	34866280	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Diffuse Gastric Cancer	Gastric Cancer	CTD_human_DG	16134180, 16367923		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intrahepatic Cholangiocarcinoma	Intrahepatic Cholangiocarcinoma	BEFREE	17550320		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	12153175		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	12883492		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	15094224		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver cirrhosis	Pubtator	35168183	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	LHGDN	12883492		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	32909215	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	12384555		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	10716965, 11704871, 15113415, 17079450, 20716965, 22220202, 29720147, 9368510		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	16575402		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of larynx	Larynx cancer	BEFREE	22049223		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	12631600, 19110304, 24982334, 29720147		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	22220202		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	15280411, 29720147		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	CTD_human_DG	16134180, 16367923		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	21042705		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	12384555, 15608670, 15720818, 22945948, 24040446, 25879031, 9368510		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	24040446		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	12384555		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	12419830		★★★★★ ★☆☆☆☆ Found in Text Mining only
Microcephaly	Microcephaly	BEFREE	28663132		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	23699600	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	15720818		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10716965, 12384555, 12419830, 12631600, 12883492, 15113415, 15720818, 16134180, 16575402, 20960451, 21042705, 22945948, 24040446, 29720147, 7657389, 8618041 View all (1 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Noninfiltrating Intraductal Carcinoma	Ductal carcinoma	BEFREE	10716965		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Diseases	Ovarian diseases	Pubtator	19110304	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	12631600, 19110304, 24982334, 29720147		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	LHGDN	12631600		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	19110304, 20132413, 29720147	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	22220202		★★★★★ ★☆☆☆☆ Found in Text Mining only
Papillomatosis	Papillomatosis	BEFREE	30613363		★★★★★ ★☆☆☆☆ Found in Text Mining only
Paraganglioma	Paraganglioma	BEFREE	28720665		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	27846214	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	15280411, 15623627, 29720147		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	15280411, 29720147	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	1335801, 30613363		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rectal Carcinoma	Rectal Carcinoma	BEFREE	28291773		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	16254461		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinal Dystrophies	Retinal Dystrophy	BEFREE	21067480		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinitis Pigmentosa	Retinitis Pigmentosa	BEFREE	21067480		★★★★★ ★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	10446990		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	15632377		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	18332876		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	PSYGENET_DG	18332876		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Squamous cell carcinoma	Carcinoma	BEFREE	17593084, 7798615		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	LHGDN	17593084		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	29720147, 33466212, 35426219	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of tongue	Tongue carcinoma	BEFREE	29720147		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	CTD_human_DG	16134180, 16367923		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stomach Neoplasms	Stomach neoplasms	Pubtator	16134180	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid associated opthalmopathies	Thyroid eye disease	BEFREE	14624395		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	23639973		★★★★★ ★☆☆☆☆ Found in Text Mining only
Undifferentiated carcinoma	Carcinoma	CTD_human_DG	12376462		★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	18843024, 36030212	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	18217980, 24040446	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Fibroids	Uterine Fibroids	BEFREE	17276435		★★★★★ ★☆☆☆☆ Found in Text Mining only

RBP1 (retinol binding protein 1)