Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	5936
Gene name	RNA binding motif protein 4
Gene symbol	RBM4
Synonyms (NCBI Gene)	LARKRBM4AZCCHC21ZCRB3A
Chromosome	11
Chromosome location	11q13.2

284

Show/Hide all (284)

miRTarBase ID	miRNA	Experiments	Reference
MIRT004193	hsa-miR-197-3p	Microarray	16822819
MIRT051520	hsa-let-7e-5p	CLASH	23622248
MIRT439800	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT439800	hsa-miR-218-5p	HITS-CLIP	23212916
MIRT1296225	hsa-miR-1200	CLIP-seq
MIRT1296226	hsa-miR-1229	CLIP-seq
MIRT1296227	hsa-miR-1252	CLIP-seq
MIRT1296228	hsa-miR-1273f	CLIP-seq
MIRT1296229	hsa-miR-3126-5p	CLIP-seq
MIRT1296230	hsa-miR-3199	CLIP-seq
MIRT1296231	hsa-miR-3974	CLIP-seq
MIRT1296232	hsa-miR-4324	CLIP-seq
MIRT1296233	hsa-miR-4419a	CLIP-seq
MIRT1296234	hsa-miR-4449	CLIP-seq
MIRT1296235	hsa-miR-4510	CLIP-seq
MIRT1296236	hsa-miR-451b	CLIP-seq
MIRT1296237	hsa-miR-4537	CLIP-seq
MIRT1296238	hsa-miR-4539	CLIP-seq
MIRT1296239	hsa-miR-4724-5p	CLIP-seq
MIRT1296240	hsa-miR-4740-5p	CLIP-seq
MIRT1296241	hsa-miR-4747-5p	CLIP-seq
MIRT1296242	hsa-miR-4766-3p	CLIP-seq
MIRT1296243	hsa-miR-4773	CLIP-seq
MIRT1296244	hsa-miR-4790-3p	CLIP-seq
MIRT1296245	hsa-miR-493	CLIP-seq
MIRT1296246	hsa-miR-544b	CLIP-seq
MIRT1296247	hsa-miR-548ag	CLIP-seq
MIRT1296248	hsa-miR-548ai	CLIP-seq
MIRT1296249	hsa-miR-548v	CLIP-seq
MIRT1296250	hsa-miR-630	CLIP-seq
MIRT1296251	hsa-miR-1225-3p	CLIP-seq
MIRT1296252	hsa-miR-1231	CLIP-seq
MIRT1296253	hsa-miR-1233	CLIP-seq
MIRT1296254	hsa-miR-1291	CLIP-seq
MIRT1296255	hsa-miR-2054	CLIP-seq
MIRT1296256	hsa-miR-3154	CLIP-seq
MIRT1296257	hsa-miR-3197	CLIP-seq
MIRT1296258	hsa-miR-320a	CLIP-seq
MIRT1296259	hsa-miR-320b	CLIP-seq
MIRT1296260	hsa-miR-320c	CLIP-seq
MIRT1296261	hsa-miR-320d	CLIP-seq
MIRT1296262	hsa-miR-328	CLIP-seq
MIRT1296263	hsa-miR-3607-3p	CLIP-seq
MIRT1296264	hsa-miR-3614-5p	CLIP-seq
MIRT1296265	hsa-miR-3686	CLIP-seq
MIRT1296266	hsa-miR-3919	CLIP-seq
MIRT1296267	hsa-miR-4288	CLIP-seq
MIRT1296268	hsa-miR-4429	CLIP-seq
MIRT1296269	hsa-miR-4433	CLIP-seq
MIRT1296270	hsa-miR-4471	CLIP-seq
MIRT1296271	hsa-miR-4756-3p	CLIP-seq
MIRT1296272	hsa-miR-632	CLIP-seq
MIRT1296273	hsa-miR-665	CLIP-seq
MIRT1296251	hsa-miR-1225-3p	CLIP-seq
MIRT1296253	hsa-miR-1233	CLIP-seq
MIRT1552994	hsa-miR-3135	CLIP-seq
MIRT1296264	hsa-miR-3614-5p	CLIP-seq
MIRT1296269	hsa-miR-4433	CLIP-seq
MIRT1552995	hsa-miR-649	CLIP-seq
MIRT1296273	hsa-miR-665	CLIP-seq
MIRT1556962	hsa-miR-10a	CLIP-seq
MIRT1556963	hsa-miR-10b	CLIP-seq
MIRT1556964	hsa-miR-1283	CLIP-seq
MIRT1556965	hsa-miR-339-5p	CLIP-seq
MIRT1556966	hsa-miR-3667-5p	CLIP-seq
MIRT1556967	hsa-miR-4421	CLIP-seq
MIRT1296236	hsa-miR-451b	CLIP-seq
MIRT1556968	hsa-miR-4684-5p	CLIP-seq
MIRT1556969	hsa-miR-4696	CLIP-seq
MIRT1556970	hsa-miR-4725-5p	CLIP-seq
MIRT1556971	hsa-miR-504	CLIP-seq
MIRT1556972	hsa-miR-520d-5p	CLIP-seq
MIRT1556973	hsa-miR-524-5p	CLIP-seq
MIRT1556974	hsa-miR-593	CLIP-seq
MIRT2088047	hsa-miR-1245	CLIP-seq
MIRT1296228	hsa-miR-1273f	CLIP-seq
MIRT2088048	hsa-miR-3614-3p	CLIP-seq
MIRT2088049	hsa-miR-3619-3p	CLIP-seq
MIRT2088050	hsa-miR-3669	CLIP-seq
MIRT1296231	hsa-miR-3974	CLIP-seq
MIRT2088051	hsa-miR-4311	CLIP-seq
MIRT1296236	hsa-miR-451b	CLIP-seq
MIRT2088052	hsa-miR-4520b-3p	CLIP-seq
MIRT2088053	hsa-miR-4529-3p	CLIP-seq
MIRT2088054	hsa-miR-4535	CLIP-seq
MIRT2088055	hsa-miR-4660	CLIP-seq
MIRT2088056	hsa-miR-4722-5p	CLIP-seq
MIRT1296242	hsa-miR-4766-3p	CLIP-seq
MIRT2088057	hsa-miR-4776-5p	CLIP-seq
MIRT1296247	hsa-miR-548ag	CLIP-seq
MIRT1296248	hsa-miR-548ai	CLIP-seq
MIRT2088058	hsa-miR-601	CLIP-seq
MIRT2088059	hsa-miR-618	CLIP-seq
MIRT2088060	hsa-miR-640	CLIP-seq
MIRT1296225	hsa-miR-1200	CLIP-seq
MIRT2312924	hsa-miR-1207-5p	CLIP-seq
MIRT2312925	hsa-miR-1321	CLIP-seq
MIRT2312926	hsa-miR-140-3p	CLIP-seq
MIRT2312927	hsa-miR-1827	CLIP-seq
MIRT1296229	hsa-miR-3126-5p	CLIP-seq
MIRT2312928	hsa-miR-3130-3p	CLIP-seq
MIRT2312929	hsa-miR-3150b-3p	CLIP-seq
MIRT2312930	hsa-miR-3612	CLIP-seq
MIRT2312931	hsa-miR-3943	CLIP-seq
MIRT1296231	hsa-miR-3974	CLIP-seq
MIRT2312932	hsa-miR-4270	CLIP-seq
MIRT1296232	hsa-miR-4324	CLIP-seq
MIRT1296233	hsa-miR-4419a	CLIP-seq
MIRT2312933	hsa-miR-4441	CLIP-seq
MIRT1296235	hsa-miR-4510	CLIP-seq
MIRT2088056	hsa-miR-4722-5p	CLIP-seq
MIRT2312934	hsa-miR-4739	CLIP-seq
MIRT2312935	hsa-miR-4756-5p	CLIP-seq
MIRT2312936	hsa-miR-4763-3p	CLIP-seq
MIRT2312937	hsa-miR-4784	CLIP-seq
MIRT2312938	hsa-miR-4793-3p	CLIP-seq
MIRT2312939	hsa-miR-544	CLIP-seq
MIRT1296246	hsa-miR-544b	CLIP-seq
MIRT1296247	hsa-miR-548ag	CLIP-seq
MIRT1296248	hsa-miR-548ai	CLIP-seq
MIRT2312940	hsa-miR-650	CLIP-seq
MIRT2312941	hsa-miR-765	CLIP-seq
MIRT2312942	hsa-miR-940	CLIP-seq
MIRT1296252	hsa-miR-1231	CLIP-seq
MIRT2312924	hsa-miR-1207-5p	CLIP-seq
MIRT2312925	hsa-miR-1321	CLIP-seq
MIRT2312926	hsa-miR-140-3p	CLIP-seq
MIRT2312927	hsa-miR-1827	CLIP-seq
MIRT2312928	hsa-miR-3130-3p	CLIP-seq
MIRT2312929	hsa-miR-3150b-3p	CLIP-seq
MIRT2312931	hsa-miR-3943	CLIP-seq
MIRT2312932	hsa-miR-4270	CLIP-seq
MIRT2312933	hsa-miR-4441	CLIP-seq
MIRT2312934	hsa-miR-4739	CLIP-seq
MIRT2312935	hsa-miR-4756-5p	CLIP-seq
MIRT2312936	hsa-miR-4763-3p	CLIP-seq
MIRT2312937	hsa-miR-4784	CLIP-seq
MIRT2312938	hsa-miR-4793-3p	CLIP-seq
MIRT2312939	hsa-miR-544	CLIP-seq
MIRT2312941	hsa-miR-765	CLIP-seq
MIRT2312942	hsa-miR-940	CLIP-seq
MIRT1556962	hsa-miR-10a	CLIP-seq
MIRT1556963	hsa-miR-10b	CLIP-seq
MIRT1296252	hsa-miR-1231	CLIP-seq
MIRT2457914	hsa-miR-1278	CLIP-seq
MIRT1556964	hsa-miR-1283	CLIP-seq
MIRT1296254	hsa-miR-1291	CLIP-seq
MIRT1296255	hsa-miR-2054	CLIP-seq
MIRT2457915	hsa-miR-3125	CLIP-seq
MIRT1552994	hsa-miR-3135	CLIP-seq
MIRT1296256	hsa-miR-3154	CLIP-seq
MIRT2457916	hsa-miR-3161	CLIP-seq
MIRT1296258	hsa-miR-320a	CLIP-seq
MIRT1296259	hsa-miR-320b	CLIP-seq
MIRT1296260	hsa-miR-320c	CLIP-seq
MIRT1296261	hsa-miR-320d	CLIP-seq
MIRT1296262	hsa-miR-328	CLIP-seq
MIRT1556965	hsa-miR-339-5p	CLIP-seq
MIRT1296263	hsa-miR-3607-3p	CLIP-seq
MIRT2457917	hsa-miR-361-3p	CLIP-seq
MIRT2457918	hsa-miR-3646	CLIP-seq
MIRT2457919	hsa-miR-3647-3p	CLIP-seq
MIRT1556966	hsa-miR-3667-5p	CLIP-seq
MIRT2457920	hsa-miR-3679-3p	CLIP-seq
MIRT1296265	hsa-miR-3686	CLIP-seq
MIRT2457921	hsa-miR-3916	CLIP-seq
MIRT1296266	hsa-miR-3919	CLIP-seq
MIRT2457922	hsa-miR-3927	CLIP-seq
MIRT2457923	hsa-miR-3928	CLIP-seq
MIRT1296267	hsa-miR-4288	CLIP-seq
MIRT1556967	hsa-miR-4421	CLIP-seq
MIRT2457924	hsa-miR-4424	CLIP-seq
MIRT1296268	hsa-miR-4429	CLIP-seq
MIRT1296269	hsa-miR-4433	CLIP-seq
MIRT2457925	hsa-miR-4446-5p	CLIP-seq
MIRT1296270	hsa-miR-4471	CLIP-seq
MIRT1296236	hsa-miR-451b	CLIP-seq
MIRT2457926	hsa-miR-4650-3p	CLIP-seq
MIRT1556968	hsa-miR-4684-5p	CLIP-seq
MIRT1556969	hsa-miR-4696	CLIP-seq
MIRT2457927	hsa-miR-4709-3p	CLIP-seq
MIRT1556970	hsa-miR-4725-5p	CLIP-seq
MIRT1296271	hsa-miR-4756-3p	CLIP-seq
MIRT2457928	hsa-miR-4797-5p	CLIP-seq
MIRT2457929	hsa-miR-485-5p	CLIP-seq
MIRT2457930	hsa-miR-488	CLIP-seq
MIRT1556971	hsa-miR-504	CLIP-seq
MIRT1556972	hsa-miR-520d-5p	CLIP-seq
MIRT1556973	hsa-miR-524-5p	CLIP-seq
MIRT2457931	hsa-miR-548ac	CLIP-seq
MIRT2457932	hsa-miR-548d-3p	CLIP-seq
MIRT2457933	hsa-miR-548m	CLIP-seq
MIRT2457934	hsa-miR-548z	CLIP-seq
MIRT2457935	hsa-miR-562	CLIP-seq
MIRT2457936	hsa-miR-579	CLIP-seq
MIRT1556974	hsa-miR-593	CLIP-seq
MIRT1296272	hsa-miR-632	CLIP-seq
MIRT2457937	hsa-miR-653	CLIP-seq
MIRT1296273	hsa-miR-665	CLIP-seq
MIRT2457938	hsa-miR-877	CLIP-seq
MIRT2457924	hsa-miR-4424	CLIP-seq
MIRT1296269	hsa-miR-4433	CLIP-seq
MIRT2465959	hsa-miR-4653-3p	CLIP-seq
MIRT2457929	hsa-miR-485-5p	CLIP-seq
MIRT2465960	hsa-miR-583	CLIP-seq
MIRT1296273	hsa-miR-665	CLIP-seq
MIRT2312924	hsa-miR-1207-5p	CLIP-seq
MIRT1296226	hsa-miR-1229	CLIP-seq
MIRT1296227	hsa-miR-1252	CLIP-seq
MIRT2609212	hsa-miR-1253	CLIP-seq
MIRT2312925	hsa-miR-1321	CLIP-seq
MIRT2312926	hsa-miR-140-3p	CLIP-seq
MIRT2312927	hsa-miR-1827	CLIP-seq
MIRT2312928	hsa-miR-3130-3p	CLIP-seq
MIRT2312929	hsa-miR-3150b-3p	CLIP-seq
MIRT2609213	hsa-miR-3192	CLIP-seq
MIRT2312930	hsa-miR-3612	CLIP-seq
MIRT2609214	hsa-miR-370	CLIP-seq
MIRT2609215	hsa-miR-3925-5p	CLIP-seq
MIRT2312931	hsa-miR-3943	CLIP-seq
MIRT1296231	hsa-miR-3974	CLIP-seq
MIRT2312932	hsa-miR-4270	CLIP-seq
MIRT2609216	hsa-miR-4434	CLIP-seq
MIRT2312933	hsa-miR-4441	CLIP-seq
MIRT2609217	hsa-miR-4459	CLIP-seq
MIRT2609218	hsa-miR-4516	CLIP-seq
MIRT2609219	hsa-miR-4695-5p	CLIP-seq
MIRT2088056	hsa-miR-4722-5p	CLIP-seq
MIRT2609220	hsa-miR-4731-5p	CLIP-seq
MIRT2312934	hsa-miR-4739	CLIP-seq
MIRT1296241	hsa-miR-4747-5p	CLIP-seq
MIRT2312935	hsa-miR-4756-5p	CLIP-seq
MIRT2312936	hsa-miR-4763-3p	CLIP-seq
MIRT1296243	hsa-miR-4773	CLIP-seq
MIRT2312937	hsa-miR-4784	CLIP-seq
MIRT1296244	hsa-miR-4790-3p	CLIP-seq
MIRT2312938	hsa-miR-4793-3p	CLIP-seq
MIRT2312939	hsa-miR-544	CLIP-seq
MIRT1296249	hsa-miR-548v	CLIP-seq
MIRT2312940	hsa-miR-650	CLIP-seq
MIRT2312941	hsa-miR-765	CLIP-seq
MIRT2312942	hsa-miR-940	CLIP-seq
MIRT2088056	hsa-miR-4722-5p	CLIP-seq
MIRT2312924	hsa-miR-1207-5p	CLIP-seq
MIRT1296226	hsa-miR-1229	CLIP-seq
MIRT1296227	hsa-miR-1252	CLIP-seq
MIRT2609212	hsa-miR-1253	CLIP-seq
MIRT2312925	hsa-miR-1321	CLIP-seq
MIRT2312926	hsa-miR-140-3p	CLIP-seq
MIRT2312927	hsa-miR-1827	CLIP-seq
MIRT2457915	hsa-miR-3125	CLIP-seq
MIRT2312928	hsa-miR-3130-3p	CLIP-seq
MIRT2312929	hsa-miR-3150b-3p	CLIP-seq
MIRT2609213	hsa-miR-3192	CLIP-seq
MIRT2312930	hsa-miR-3612	CLIP-seq
MIRT2609214	hsa-miR-370	CLIP-seq
MIRT2457921	hsa-miR-3916	CLIP-seq
MIRT2609215	hsa-miR-3925-5p	CLIP-seq
MIRT2312931	hsa-miR-3943	CLIP-seq
MIRT1296231	hsa-miR-3974	CLIP-seq
MIRT2312932	hsa-miR-4270	CLIP-seq
MIRT2609216	hsa-miR-4434	CLIP-seq
MIRT2312933	hsa-miR-4441	CLIP-seq
MIRT2609217	hsa-miR-4459	CLIP-seq
MIRT2609218	hsa-miR-4516	CLIP-seq
MIRT1296238	hsa-miR-4539	CLIP-seq
MIRT2609219	hsa-miR-4695-5p	CLIP-seq
MIRT2088056	hsa-miR-4722-5p	CLIP-seq
MIRT2609220	hsa-miR-4731-5p	CLIP-seq
MIRT2312934	hsa-miR-4739	CLIP-seq
MIRT1296241	hsa-miR-4747-5p	CLIP-seq
MIRT2312935	hsa-miR-4756-5p	CLIP-seq
MIRT2312936	hsa-miR-4763-3p	CLIP-seq
MIRT2689458	hsa-miR-4768-3p	CLIP-seq
MIRT1296243	hsa-miR-4773	CLIP-seq
MIRT2312937	hsa-miR-4784	CLIP-seq
MIRT1296244	hsa-miR-4790-3p	CLIP-seq
MIRT2312938	hsa-miR-4793-3p	CLIP-seq
MIRT1296245	hsa-miR-493	CLIP-seq
MIRT2312939	hsa-miR-544	CLIP-seq
MIRT1296249	hsa-miR-548v	CLIP-seq
MIRT2312940	hsa-miR-650	CLIP-seq
MIRT2312941	hsa-miR-765	CLIP-seq
MIRT2312942	hsa-miR-940	CLIP-seq

Show/Hide all (61)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000381	Process	Regulation of alternative mRNA splicing, via spliceosome	IBA
GO:0000381	Process	Regulation of alternative mRNA splicing, via spliceosome	IDA	12628928, 16260624, 16777844, 16934801, 21518792
GO:0000381	Process	Regulation of alternative mRNA splicing, via spliceosome	IEA
GO:0002190	Process	Cap-independent translational initiation	IDA	17284590
GO:0002192	Process	IRES-dependent translational initiation of linear mRNA	IDA	17284590
GO:0003676	Function	Nucleic acid binding	IEA
GO:0003723	Function	RNA binding	HDA	22658674, 22681889
GO:0003723	Function	RNA binding	IDA	19561594
GO:0003723	Function	RNA binding	IEA
GO:0003723	Function	RNA binding	TAS	9169144
GO:0003729	Function	MRNA binding	IBA
GO:0003729	Function	MRNA binding	IDA	21518792
GO:0003730	Function	MRNA 3'-UTR binding	IEA
GO:0003730	Function	MRNA 3'-UTR binding	ISS
GO:0005515	Function	Protein binding	IPI	12628928, 16934801, 17284590, 19801630, 21343338, 22678294, 32814053, 37548402
GO:0005634	Component	Nucleus	IDA	16777844, 16907643, 17284590
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA	12628928
GO:0005730	Component	Nucleolus	IDA	12628928, 16907643
GO:0005730	Component	Nucleolus	IEA
GO:0005737	Component	Cytoplasm	IDA	12628928, 16777844, 16907643, 17284590
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA
GO:0006396	Process	RNA processing	TAS	9169144
GO:0006397	Process	MRNA processing	IEA
GO:0007623	Process	Circadian rhythm	IBA
GO:0008270	Function	Zinc ion binding	IEA
GO:0008380	Process	RNA splicing	IEA
GO:0010468	Process	Regulation of gene expression	IEA
GO:0010494	Component	Cytoplasmic stress granule	IDA	17284590
GO:0016607	Component	Nuclear speck	IBA
GO:0016607	Component	Nuclear speck	IDA	12628928, 16907643
GO:0016607	Component	Nuclear speck	IEA
GO:0017148	Process	Negative regulation of translation	IDA	17284590
GO:0030154	Process	Cell differentiation	IEA
GO:0030332	Function	Cyclin binding	IPI	15159402
GO:0031016	Process	Pancreas development	IEA
GO:0031047	Process	Regulatory ncRNA-mediated gene silencing	IEA
GO:0032055	Process	Negative regulation of translation in response to stress	IDA	17284590
GO:0032922	Process	Circadian regulation of gene expression	IEA
GO:0035198	Function	MiRNA binding	IDA	19801630
GO:0035278	Process	MiRNA-mediated gene silencing by inhibition of translation	IDA	19801630
GO:0035773	Process	Insulin secretion involved in cellular response to glucose stimulus	IEA
GO:0035883	Process	Enteroendocrine cell differentiation	IEA
GO:0036002	Function	Pre-mRNA binding	IEA
GO:0042593	Process	Glucose homeostasis	IEA
GO:0043153	Process	Entrainment of circadian clock by photoperiod	IEA
GO:0043153	Process	Entrainment of circadian clock by photoperiod	ISS
GO:0045727	Process	Positive regulation of translation	IEA
GO:0045947	Process	Negative regulation of translational initiation	IDA	19801630
GO:0046626	Process	Regulation of insulin receptor signaling pathway	IEA
GO:0046685	Process	Response to arsenic-containing substance	IDA	17284590
GO:0046822	Process	Regulation of nucleocytoplasmic transport	IDA	12628928, 17284590
GO:0046822	Process	Regulation of nucleocytoplasmic transport	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0048471	Component	Perinuclear region of cytoplasm	IEA
GO:0051149	Process	Positive regulation of muscle cell differentiation	IDA	21518792
GO:0097157	Function	Pre-mRNA intronic binding	IDA	16260624
GO:0097158	Function	Pre-mRNA intronic pyrimidine-rich binding	IDA	16260624, 16777844
GO:0097167	Process	Circadian regulation of translation	IEA
GO:0097167	Process	Circadian regulation of translation	ISS

MIM	HGNC	e!Ensembl
602571	9901	ENSG00000173933

Q9BWF3

Protein name

RNA-binding protein 4 (Lark homolog) (hLark) (RNA-binding motif protein 4) (RNA-binding motif protein 4a)

Protein function

RNA-binding factor involved in multiple aspects of cellular processes like alternative splicing of pre-mRNA and translation regulation. Modulates alternative 5'-splice site and exon selection. Acts as a muscle cell differentiation-promoting fact

PDB

2DNQ

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00076	RRM_1	4 → 66	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)	Domain
PF00076	RRM_1	80 → 142	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)	Domain
PF00098	zf-CCHC	160 → 177	Zinc knuckle	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in the cerebellum. Expressed in neurons and glial cells, including layers II neurons in the frontal cortex and CA1 pyramidal neurons in the hippocampus. Expressed in heart, liver, pancreas, skeletal muscle, placenta, primary

Sequence

MVKLFIGNLPREATEQEIRSLFEQYGKVLECDIIKNYGFVHIEDKTAAEDAIRNLHHYKL
HGVNINVEASKNKSKTSTKLHVGNISPTCTNKELRAKFEEYGPVIECDIVKDYAFVHMER
AEDAVEAIRGLDNTEFQGKRMHVQLSTSRLRTAPGMGDQSGCYRCGKEGHWSKECPIDRS
GRVADLTEQYNEQYGAVRTPYTMSYGDSLYYNNAYGALDAYYKRCRAARSYEAVAAAAAS
VYNYAEQTLSQLPQVQNTAMASHLTSTSLDPYDRHLLPTSGAAATAAAAAAAAAAVTAAS
TSYYGRDRSPLRRATAPVPTVGEGYGYGHESELSQASAAARNSLYDMARYEREQYADRAR
YSAF

Sequence length

364

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
INSOMNIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (31)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Breast Carcinoma	Breast Carcinoma	BEFREE	25140042, 28138257		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	25140042	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	26506517	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	28138257		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	35718636	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	26506517, 28276498, 29138007	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Down Syndrome	Down Syndrome	LHGDN	12469345		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	28754317		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	28754317		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	37080995	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	35832652	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	31487546		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	39214303	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	39214303	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	28138257		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	31491447, 36639375	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	27324405	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malformations of Cortical Development, Group II	Malformation of cortical development	BEFREE	29581187		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	25140042, 28138257		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	28754317		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	28138257		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	27324405, 28138257, 31145716		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	19416963, 25203323, 25367940, 26898347		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	25203323, 26898347, 27291620, 28138257, 31145716		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rectal Carcinoma	Rectal Carcinoma	BEFREE	26898347		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rufous oculocutaneous albinism	Rufous oculocutaneous albinism	Pubtator	27324405	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sepsis	Sepsis	Pubtator	23897118	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	27324405, 28138257, 31145716		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	27324405	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	34195294	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Tauopathies	Tauopathies	LHGDN	16777844		★★★★★ ★☆☆☆☆ Found in Text Mining only

RBM4 (RNA binding motif protein 4)