Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	59353
Gene name	Transmembrane protein 35A
Gene symbol	TMEM35A
Synonyms (NCBI Gene)	NACHOTMEM35TUF-1
Chromosome	X
Chromosome location	Xq22.1

Show/Hide all (21)

miRTarBase ID	miRNA	Experiments	Reference
MIRT625851	hsa-miR-8485	HITS-CLIP	23313552
MIRT625850	hsa-miR-4797-5p	HITS-CLIP	23313552
MIRT625849	hsa-miR-1244	HITS-CLIP	23313552
MIRT625851	hsa-miR-8485	HITS-CLIP	23824327
MIRT625850	hsa-miR-4797-5p	HITS-CLIP	23824327
MIRT625849	hsa-miR-1244	HITS-CLIP	23824327
MIRT625851	hsa-miR-8485	HITS-CLIP	23824327
MIRT625850	hsa-miR-4797-5p	HITS-CLIP	23824327
MIRT625849	hsa-miR-1244	HITS-CLIP	23824327
MIRT625851	hsa-miR-8485	HITS-CLIP	23824327
MIRT625850	hsa-miR-4797-5p	HITS-CLIP	23824327
MIRT625849	hsa-miR-1244	HITS-CLIP	23824327
MIRT625851	hsa-miR-8485	HITS-CLIP	23824327
MIRT625850	hsa-miR-4797-5p	HITS-CLIP	23824327
MIRT625849	hsa-miR-1244	HITS-CLIP	23824327
MIRT625851	hsa-miR-8485	HITS-CLIP	23824327
MIRT625850	hsa-miR-4797-5p	HITS-CLIP	23824327
MIRT625849	hsa-miR-1244	HITS-CLIP	23824327
MIRT625851	hsa-miR-8485	HITS-CLIP	23824327
MIRT625850	hsa-miR-4797-5p	HITS-CLIP	23824327
MIRT625849	hsa-miR-1244	HITS-CLIP	23824327

Show/Hide all (19)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005777	Component	Peroxisome	IEA
GO:0005778	Component	Peroxisomal membrane	IEA
GO:0005783	Component	Endoplasmic reticulum	IBA
GO:0005783	Component	Endoplasmic reticulum	IDA	26875622
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005789	Component	Endoplasmic reticulum membrane	IEA
GO:0016020	Component	Membrane	IEA
GO:0030548	Function	Acetylcholine receptor regulator activity	IBA
GO:0030548	Function	Acetylcholine receptor regulator activity	IDA	26875622, 27789755, 28445721, 32783947
GO:0030548	Function	Acetylcholine receptor regulator activity	IEA
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0051131	Process	Chaperone-mediated protein complex assembly	IBA
GO:0051131	Process	Chaperone-mediated protein complex assembly	IDA	26875622, 28445721, 32783947
GO:0051131	Process	Chaperone-mediated protein complex assembly	IEA
GO:0051131	Process	Chaperone-mediated protein complex assembly	IMP	26875622
GO:2000010	Process	Positive regulation of protein localization to cell surface	IBA
GO:2000010	Process	Positive regulation of protein localization to cell surface	IDA	26875622, 27789755, 28445721, 32204458, 32783947
GO:2000010	Process	Positive regulation of protein localization to cell surface	IEA

MIM	HGNC	e!Ensembl
HGNC	N/A	HGNC

Q53FP2

Protein name

Novel acetylcholine receptor chaperone

Protein function

Molecular chaperone which mediates the proper assembly and functional expression of the nicotinic acetylcholine receptors (nAChRs) throughout the brain (PubMed:26875622, PubMed:27789755, PubMed:28445721, PubMed:32204458, PubMed:32783947). Essent

PDB

9H9E

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF13564	DoxX_2	11 → 127	DoxX-like family	Family

Sequence

MASPRTVTIVALSVALGLFFVFMGTIKLTPRLSKDAYSEMKRAYKSYVRALPLLKKMGIN
SILLRKSIGALEVACGIVMTLVPGRPKDVANFFLLLLVLAVLFFHQLVGDPLKRYAHALV
FGILLTCRLLIARKPEDRSSEKKPLPGNAEEQPSLYEKAPQGKVKVS

Sequence length

167

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
GOUT	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

TMEM35A (transmembrane protein 35A)