Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	59348
Gene name	Zinc finger protein 350
Gene symbol	ZNF350
Synonyms (NCBI Gene)	ZBRK1ZFQR
Chromosome	19
Chromosome location	19q13.41

101

Show/Hide all (101)

miRTarBase ID	miRNA	Experiments	Reference
MIRT025098	hsa-miR-181a-5p	Sequencing	20371350
MIRT348739	hsa-miR-4789-3p	PAR-CLIP	20371350
MIRT574265	hsa-miR-101-3p	PAR-CLIP	20371350
MIRT574274	hsa-miR-144-3p	PAR-CLIP	20371350
MIRT574272	hsa-miR-5580-3p	PAR-CLIP	20371350
MIRT574273	hsa-miR-6512-5p	PAR-CLIP	20371350
MIRT574271	hsa-miR-511-3p	PAR-CLIP	20371350
MIRT574270	hsa-miR-6504-3p	PAR-CLIP	20371350
MIRT574269	hsa-miR-885-5p	PAR-CLIP	20371350
MIRT348730	hsa-miR-642a-3p	PAR-CLIP	20371350
MIRT348737	hsa-miR-642b-3p	PAR-CLIP	20371350
MIRT574268	hsa-miR-4433a-5p	PAR-CLIP	20371350
MIRT574267	hsa-miR-3657	PAR-CLIP	20371350
MIRT574266	hsa-miR-4669	PAR-CLIP	20371350
MIRT574265	hsa-miR-101-3p	PAR-CLIP	20371350
MIRT574264	hsa-miR-582-5p	PAR-CLIP	20371350
MIRT574263	hsa-miR-188-3p	PAR-CLIP	20371350
MIRT574262	hsa-miR-4433b-5p	PAR-CLIP	20371350
MIRT348739	hsa-miR-4789-3p	PAR-CLIP	20371350
MIRT574265	hsa-miR-101-3p	PAR-CLIP	20371350
MIRT574274	hsa-miR-144-3p	PAR-CLIP	20371350
MIRT574272	hsa-miR-5580-3p	PAR-CLIP	20371350
MIRT574273	hsa-miR-6512-5p	PAR-CLIP	20371350
MIRT574271	hsa-miR-511-3p	PAR-CLIP	20371350
MIRT574270	hsa-miR-6504-3p	PAR-CLIP	20371350
MIRT574269	hsa-miR-885-5p	PAR-CLIP	20371350
MIRT348730	hsa-miR-642a-3p	PAR-CLIP	20371350
MIRT348737	hsa-miR-642b-3p	PAR-CLIP	20371350
MIRT574268	hsa-miR-4433a-5p	PAR-CLIP	20371350
MIRT574267	hsa-miR-3657	PAR-CLIP	20371350
MIRT574266	hsa-miR-4669	PAR-CLIP	20371350
MIRT574265	hsa-miR-101-3p	PAR-CLIP	20371350
MIRT574264	hsa-miR-582-5p	PAR-CLIP	20371350
MIRT574263	hsa-miR-188-3p	PAR-CLIP	20371350
MIRT574262	hsa-miR-4433b-5p	PAR-CLIP	20371350
MIRT2158014	hsa-miR-127-5p	CLIP-seq
MIRT2158015	hsa-miR-27a	CLIP-seq
MIRT2158016	hsa-miR-27b	CLIP-seq
MIRT2158017	hsa-miR-3663-5p	CLIP-seq
MIRT2158018	hsa-miR-4496	CLIP-seq
MIRT2158019	hsa-miR-4521	CLIP-seq
MIRT2158020	hsa-miR-4738-3p	CLIP-seq
MIRT2158021	hsa-miR-513a-5p	CLIP-seq
MIRT2158022	hsa-miR-601	CLIP-seq
MIRT2377589	hsa-miR-219-2-3p	CLIP-seq
MIRT2377590	hsa-miR-2964a-3p	CLIP-seq
MIRT2158017	hsa-miR-3663-5p	CLIP-seq
MIRT2158018	hsa-miR-4496	CLIP-seq
MIRT2158019	hsa-miR-4521	CLIP-seq
MIRT2377591	hsa-miR-4680-3p	CLIP-seq
MIRT2158020	hsa-miR-4738-3p	CLIP-seq
MIRT2377592	hsa-miR-514	CLIP-seq
MIRT2377593	hsa-miR-514b-3p	CLIP-seq
MIRT2158022	hsa-miR-601	CLIP-seq
MIRT2377594	hsa-miR-642b	CLIP-seq
MIRT2669948	hsa-miR-1255a	CLIP-seq
MIRT2669949	hsa-miR-1255b	CLIP-seq
MIRT2669950	hsa-miR-1265	CLIP-seq
MIRT2669951	hsa-miR-154	CLIP-seq
MIRT2669952	hsa-miR-218	CLIP-seq
MIRT2669953	hsa-miR-2392	CLIP-seq
MIRT2669954	hsa-miR-297	CLIP-seq
MIRT2669955	hsa-miR-302f	CLIP-seq
MIRT2669956	hsa-miR-3143	CLIP-seq
MIRT2669957	hsa-miR-3152-5p	CLIP-seq
MIRT2669958	hsa-miR-3155	CLIP-seq
MIRT2669959	hsa-miR-3155b	CLIP-seq
MIRT2669960	hsa-miR-361-5p	CLIP-seq
MIRT2669961	hsa-miR-455-5p	CLIP-seq
MIRT2669962	hsa-miR-4774-3p	CLIP-seq
MIRT2669963	hsa-miR-484	CLIP-seq
MIRT2669964	hsa-miR-567	CLIP-seq
MIRT2669965	hsa-miR-633	CLIP-seq
MIRT2669966	hsa-miR-636	CLIP-seq
MIRT2377594	hsa-miR-642b	CLIP-seq
MIRT2695968	hsa-miR-101	CLIP-seq
MIRT2669948	hsa-miR-1255a	CLIP-seq
MIRT2669949	hsa-miR-1255b	CLIP-seq
MIRT2669950	hsa-miR-1265	CLIP-seq
MIRT2695969	hsa-miR-129-3p	CLIP-seq
MIRT2695970	hsa-miR-144	CLIP-seq
MIRT2669951	hsa-miR-154	CLIP-seq
MIRT2669952	hsa-miR-218	CLIP-seq
MIRT2669953	hsa-miR-2392	CLIP-seq
MIRT2669954	hsa-miR-297	CLIP-seq
MIRT2669955	hsa-miR-302f	CLIP-seq
MIRT2669956	hsa-miR-3143	CLIP-seq
MIRT2669957	hsa-miR-3152-5p	CLIP-seq
MIRT2669958	hsa-miR-3155	CLIP-seq
MIRT2669959	hsa-miR-3155b	CLIP-seq
MIRT2669960	hsa-miR-361-5p	CLIP-seq
MIRT2669961	hsa-miR-455-5p	CLIP-seq
MIRT2695971	hsa-miR-4666-5p	CLIP-seq
MIRT2695972	hsa-miR-4687-5p	CLIP-seq
MIRT2669962	hsa-miR-4774-3p	CLIP-seq
MIRT2695973	hsa-miR-4789-5p	CLIP-seq
MIRT2669963	hsa-miR-484	CLIP-seq
MIRT2669964	hsa-miR-567	CLIP-seq
MIRT2669965	hsa-miR-633	CLIP-seq
MIRT2669966	hsa-miR-636	CLIP-seq
MIRT2377594	hsa-miR-642b	CLIP-seq

Show/Hide all (1)

Transcription factor	Regulation	Reference
E2F1	Unknown	22768064

Show/Hide all (22)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IDA	11090615
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0001162	Function	RNA polymerase II intronic transcription regulatory region sequence-specific DNA binding	IDA	11090615
GO:0001227	Function	DNA-binding transcription repressor activity, RNA polymerase II-specific	IDA	11090615
GO:0003677	Function	DNA binding	IDA	11090615
GO:0003677	Function	DNA binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IBA
GO:0005515	Function	Protein binding	IPI	11090615, 22975076, 33961781
GO:0005634	Component	Nucleus	IDA	23665872
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0006355	Process	Regulation of DNA-templated transcription	IDA	11090615
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0008270	Function	Zinc ion binding	IEA
GO:0016363	Component	Nuclear matrix	IEA
GO:0016604	Component	Nuclear body	IDA
GO:0017053	Component	Transcription repressor complex	IDA	11090615
GO:0045892	Process	Negative regulation of DNA-templated transcription	IDA	11090615
GO:0046872	Function	Metal ion binding	IEA
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IEA

MIM	HGNC	e!Ensembl
605422	16656	ENSG00000256683

Q9GZX5

Protein name

Zinc finger protein 350 (KRAB zinc finger protein ZFQR) (Zinc finger and BRCA1-interacting protein with a KRAB domain 1) (Zinc finger protein ZBRK1)

Protein function

Transcriptional repressor. Binds to a specific sequence, 5'-GGGxxxCAGxxxTTT-3', within GADD45 intron 3.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01352	KRAB	7 → 48	KRAB box	Family
PF00096	zf-C2H2	206 → 228	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	234 → 256	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	262 → 284	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	290 → 312	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	318 → 340	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	346 → 368	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	374 → 396	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	402 → 424	Zinc finger, C2H2 type	Domain

Tissue specificity

TISSUE SPECIFICITY: Widely expressed. {ECO:0000269|PubMed:11161714}.

Sequence

MIQAQESITLEDVAVDFTWEEWQLLGAAQKDLYRDVMLENYSNLVAVGYQASKPDALFKL
EQGEQLWTIEDGIHSGACSDIWKVDHVLERLQSESLVNRRKPCHEHDAFENIVHCSKSQF
LLGQNHDIFDLRGKSLKSNLTLVNQSKGYEIKNSVEFTGNGDSFLHANHERLHTAIKFPA
SQKLISTKSQFISPKHQKTRKLEKHHVCSECGKAFIKKSWLTDHQVMHTGEKPHRCSLCE
KAFSRKFMLTEHQRTHTGEKPYECPECGKAFLKKSRLNIHQKTHTGEKPYICSECGKGFI
QKGNLIVHQRIHTGEKPYICNECGKGFIQKTCLIAHQRFHTGKTPFVCSECGKSCSQKSG
LIKHQRIHTGEKPFECSECGKAFSTKQKLIVHQRTHTGERPYGCNECGKAFAYMSCLVKH
KRIHTREKQEAAKVENPPAERHSSLHTSDVMQEKNSANGATTQVPSVAPQTSLNISGLLA
NRNVVLVGQPVVRCAASGDNRGFAQDRNLVNAVNVVVPSVINYVLFYVTENP

Sequence length

532

Interactions

View interactions

	Reactome
			Generic Transcription Pathway SUMOylation of transcription cofactors

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (5)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Colorectal cancer	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (14)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Breast Carcinoma	Breast Carcinoma	BEFREE	14743505, 16485136, 17764113, 18350249, 19484476, 23151675, 23991171, 29291027, 29653063, 30524945		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	19484476, 33407485	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	15772983, 23151675		★★★★★ ★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	19996286, 23991171		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	19996286, 23991171		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	BEFREE	20926453		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	36803971	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	38049396	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	16485136, 17764113, 18350249, 19484476, 23151675, 23991171, 29291027, 29653063, 30524945		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	19996286, 23991171		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	14743505, 19996286, 23991171		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	LHGDN	12872252, 17764113		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasm	Uterine cervix neoplasm	BEFREE	19996286		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	23991171	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

ZNF350 (zinc finger protein 350)