ALOXE3 (arachidonate epidermal lipoxygenase 3)

Gene

• Entrez ID: 59344
• Gene name: Arachidonate epidermal lipoxygenase 3
• Gene symbol: ALOXE3
• Synonyms (NCBI Gene): ARCI3, E-LOX, LI5, eLOX-3, eLOX3
• Chromosome: 17
• Chromosome location: 17p13.1
• Summary: This gene is a member of the lipoxygenase family, which are catabolized by arachidonic acid-derived compounds. The encoded enzyme is a hydroperoxide isomerase that synthesizes a unique type of epoxy alcohol (8R-hydroxy-11R,12R-epoxyeicosa-5Z,9E,14Z-trieno

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs121434232	C>A,T	Pathogenic	Coding sequence variant, non coding transcript variant, missense variant
rs121434233	G>A	Pathogenic	Coding sequence variant, non coding transcript variant, stop gained
rs121434234	G>T	Pathogenic	Coding sequence variant, non coding transcript variant, missense variant
rs139375856	T>C	Pathogenic	Splice acceptor variant, downstream transcript variant, genic downstream transcript variant
rs141340759	G>A	Pathogenic	Coding sequence variant, non coding transcript variant, stop gained
rs147149459	G>A	Pathogenic	Missense variant, downstream transcript variant, non coding transcript variant, genic downstream transcript variant, coding sequence variant
rs370031870	G>A,T	Pathogenic	Non coding transcript variant, synonymous variant, stop gained, coding sequence variant
rs745480657	C>T	Pathogenic	Coding sequence variant, missense variant, non coding transcript variant
rs765682032	G>A,T	Pathogenic	Coding sequence variant, stop gained, synonymous variant, non coding transcript variant
rs781631629	G>A	Pathogenic	Stop gained, genic downstream transcript variant, coding sequence variant, 3 prime UTR variant, intron variant, downstream transcript variant
rs786205120	C>A,T	Likely-pathogenic, pathogenic	Missense variant, coding sequence variant, non coding transcript variant
rs1296095311	T>C	Likely-pathogenic	Missense variant, coding sequence variant, non coding transcript variant
rs1311967606	G>A,T	Likely-pathogenic	Missense variant, non coding transcript variant, synonymous variant, coding sequence variant, genic downstream transcript variant
rs1355284797	A>G	Pathogenic	Non coding transcript variant, coding sequence variant, missense variant
rs1567999245	G>T	Pathogenic	Coding sequence variant, non coding transcript variant, stop gained
rs1568005543	A>T	Pathogenic	Coding sequence variant, non coding transcript variant, stop gained
rs1598209965	T>-	Pathogenic	Frameshift variant, coding sequence variant, non coding transcript variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT778925	hsa-miR-1255a	CLIP-seq
MIRT778926	hsa-miR-1255b	CLIP-seq
MIRT778927	hsa-miR-2110	CLIP-seq
MIRT778928	hsa-miR-3126-5p	CLIP-seq
MIRT778929	hsa-miR-3150a-3p	CLIP-seq
MIRT778930	hsa-miR-3175	CLIP-seq
MIRT778931	hsa-miR-3605-5p	CLIP-seq
MIRT778932	hsa-miR-4419a	CLIP-seq
MIRT778933	hsa-miR-4510	CLIP-seq
MIRT778934	hsa-miR-4535	CLIP-seq
MIRT778935	hsa-miR-4659a-3p	CLIP-seq
MIRT778936	hsa-miR-4659b-3p	CLIP-seq
MIRT778937	hsa-miR-4776-5p	CLIP-seq
MIRT778938	hsa-miR-492	CLIP-seq
MIRT778939	hsa-miR-939	CLIP-seq
MIRT1929926	hsa-miR-647	CLIP-seq
MIRT778925	hsa-miR-1255a	CLIP-seq
MIRT778926	hsa-miR-1255b	CLIP-seq
MIRT778927	hsa-miR-2110	CLIP-seq
MIRT778928	hsa-miR-3126-5p	CLIP-seq
MIRT778929	hsa-miR-3150a-3p	CLIP-seq
MIRT778930	hsa-miR-3175	CLIP-seq
MIRT778931	hsa-miR-3605-5p	CLIP-seq
MIRT778932	hsa-miR-4419a	CLIP-seq
MIRT778933	hsa-miR-4510	CLIP-seq
MIRT778939	hsa-miR-939	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005506	Function	Iron ion binding	IEA
GO:0005515	Function	Protein binding	IPI	28514442, 32296183, 33961781
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	TAS
GO:0006629	Process	Lipid metabolic process	IEA
GO:0006631	Process	Fatty acid metabolic process	IEA
GO:0006665	Process	Sphingolipid metabolic process	IDA	21558561
GO:0006665	Process	Sphingolipid metabolic process	IEA
GO:0016020	Component	Membrane	IEA
GO:0016491	Function	Oxidoreductase activity	IEA
GO:0016702	Function	Oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen	IDA	12881489
GO:0016702	Function	Oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen	IDA	20921226, 20923767
GO:0016829	Function	Lyase activity	IEA
GO:0016853	Function	Isomerase activity	IEA
GO:0019233	Process	Sensory perception of pain	IEA
GO:0019233	Process	Sensory perception of pain	ISS
GO:0019369	Process	Arachidonate metabolic process	IBA
GO:0019369	Process	Arachidonate metabolic process	IDA	12881489, 17045234
GO:0019369	Process	Arachidonate metabolic process	IEA
GO:0019372	Process	Lipoxygenase pathway	IBA
GO:0019372	Process	Lipoxygenase pathway	IDA	20921226
GO:0019372	Process	Lipoxygenase pathway	TAS
GO:0034440	Process	Lipid oxidation	IEA
GO:0035357	Process	Peroxisome proliferator activated receptor signaling pathway	IEA
GO:0035357	Process	Peroxisome proliferator activated receptor signaling pathway	ISS
GO:0043651	Process	Linoleic acid metabolic process	IBA
GO:0043651	Process	Linoleic acid metabolic process	IDA	12881489, 17045234
GO:0043651	Process	Linoleic acid metabolic process	IEA
GO:0045444	Process	Fat cell differentiation	IEA
GO:0045444	Process	Fat cell differentiation	ISS
GO:0046513	Process	Ceramide biosynthetic process	IEA
GO:0046513	Process	Ceramide biosynthetic process	ISS
GO:0046872	Function	Metal ion binding	IEA
GO:0050486	Function	Intramolecular hydroxytransferase activity	IDA	20923767, 21558561
GO:0051122	Process	Hepoxilin biosynthetic process	IBA
GO:0051122	Process	Hepoxilin biosynthetic process	IDA	12881489, 17045234
GO:0051122	Process	Hepoxilin biosynthetic process	IEA
GO:0051213	Function	Dioxygenase activity	IEA
GO:0061436	Process	Establishment of skin barrier	IEA
GO:0061436	Process	Establishment of skin barrier	ISS
GO:0106255	Function	Hydroperoxy icosatetraenoate isomerase activity	IBA
GO:0106255	Function	Hydroperoxy icosatetraenoate isomerase activity	IDA	12881489, 17045234
GO:0106255	Function	Hydroperoxy icosatetraenoate isomerase activity	IEA
GO:0106255	Function	Hydroperoxy icosatetraenoate isomerase activity	TAS
GO:0106256	Function	Hydroperoxy icosatetraenoate dehydratase activity	IEA

Other IDs

• MIM: 607206
• HGNC: 13743
• e!Ensembl: ENSG00000179148

Protein

• UniProt ID: Q9BYJ1
• Protein name: Hydroperoxide isomerase ALOXE3 (Epidermis-type lipoxygenase 3) (Epidermal LOX-3) (e-LOX-3) (eLOX-3) (Hydroperoxy dehydratase ALOXE3) (Hydroperoxy icosatetraenoate dehydratase) (EC 4.2.1.152) (Hydroperoxy icosatetraenoate isomerase) (EC 5.4.4.7)
• Protein function: Non-heme iron-containing lipoxygenase which is atypical in that it displays a prominent hydroperoxide isomerase activity and a reduced lipoxygenases activity (PubMed:12881489, PubMed:17045234, PubMed:20921226, PubMed:20923767). The hydroperoxide
• PDB: 6VB2
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01477	PLAT	4 → 113	PLAT/LH2 domain	Domain
  PF00305	Lipoxygenase	211 → 697	Lipoxygenase	Domain

• Tissue specificity: TISSUE SPECIFICITY: Predominantly expressed in skin.
• Sequence:

  MAVYRLCVTTGPYLRAGTLDNISVTLVGTCGESPKQRLDRMGRDFAPGSVQKYKVRCTAE
  LGELLLLRVHKERYAFFRKDSWYCSRICVTEPDGSVSHFPCYQWIEGYCTVELRPGTART
  ICQDSLPLLLDHRTRELRARQECYRWKIYAPGFPCMVDVNSFQEMESDKKFALTKTTTCV
  DQGDSSGNRYLPGFPMKIDIPSLMYMEPNVRYSATKTISLLFNAIPASLGMKLRGLLDRK
  GSWKKLDDMQNIFWCHKTFTTKYVTEHWCEDHFFGYQYLNGVNPVMLHCISSLPSKLPVT
  NDMVAPLLGQDTCLQTELERGNIFLADYWILAEAPTHCLNGRQQYVAAPLCLLWLSPQGA
  LVPLAIQLSQTPGPDSPIFLPTDSEWDWLLAKTWVRNSEFLVHENNTHFLCTHLLCEAFA
  MATLRQLPLCHPIYKLLLPHTRYTLQVNTIARATLLNPEGLVDQVTSIGRQGLIYLMSTG
  LAHFTYTNFCLPDSLRARGVLAIPNYHYRDDGLKIWAAIESFVSEIVGYYYPSDASVQQD
  SELQAWTGEIFAQAFLGRESSGFPSRLCTPGEMVKFLTAIIFNCSAQHAAVNSGQHDFGA
  WMPNAPSSMRQPPPQTKGTTTLKTYLDTLPEVNISCNNLLLFWLVSQEPKDQRPLGTYPD
  EHFTEEAPRRSIAAFQSRLAQISRDIQERNQGLALPYTYLDPPLIENSVSI

• Sequence length: 711

Pathways

KEGG:

Arachidonic acid metabolism
Metabolic pathways

Reactome:

Synthesis of 12-eicosatetraenoic acid derivatives

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
ALOXE3-related disorder	Pathogenic	rs121434233, rs147149459, rs141340759	RCV003944796 RCV003920029 RCV003398653	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Autosomal recessive congenital ichthyosis	Pathogenic	rs147149459	RCV000615069	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Autosomal recessive congenital ichthyosis 2	Pathogenic; Likely pathogenic	rs121434233, rs777240858, rs1311967606, rs1296095311, rs765682032, rs1568005543	RCV005357068 RCV005356403 RCV000782398 RCV000782397 RCV000782396 RCV000782395	★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Autosomal recessive congenital ichthyosis 3	Pathogenic; Likely pathogenic	rs2151838171, rs754701941, rs121434232, rs121434233, rs121434234, rs370031870, rs1415942704, rs147149459, rs777240858, rs139375856, rs786205120, rs745480657, rs1355284797, rs1296095311, rs765682032, rs141340759, rs1163280866, rs764781178, rs1979042162, rs568695601, rs1979055447, rs1979055873, rs1979807431, rs1979909742, rs1567999431, rs1979917479, rs1979924544, rs1979931284, rs767046669, rs1979966591, rs1427770703, rs1472087421, rs1980084767, rs1980145171, rs1980522554, rs1980627156, rs1980629564, rs367827093, rs1980748884, rs769980324	RCV001783428 RCV001785913 RCV000003576 RCV000003577 RCV000003578 RCV000201260 RCV003147012 RCV000032747 RCV003333496 RCV001289477 RCV000032746 RCV000032748 RCV000032749 RCV001289504 RCV002470977 RCV001289484 RCV001249459 RCV001262620 RCV001289498 RCV001289490 RCV001289482 RCV001289481 RCV001289499 RCV001289485 RCV001289494 RCV001289501 RCV001289476 RCV001289502 RCV001289492 RCV001289495 RCV001289479 RCV001289487 RCV001289493 RCV001289478 RCV001289483 RCV001289480 RCV001289500 RCV001289491 RCV001289488 RCV001289486	★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Congenital nonbullous ichthyosiform erythroderma	Pathogenic	rs781631629	RCV001849396	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Ichthyosis	Pathogenic	rs370031870	RCV000755138	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Lamellar ichthyosis	Pathogenic; Likely pathogenic	rs370031870, rs141115577, rs147149459, rs781631629, rs1311967606, rs1296095311, rs764781178	RCV002469062 RCV003226839 RCV001844106 RCV001291298 RCV003117573 RCV004768646 RCV002282503	★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Trichohepatoenteric syndrome 2	Pathogenic	rs764781178	RCV005861223	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
AUTISM SPECTRUM DISORDER	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Congenital ichthyosiform erythroderma	Uncertain significance; Benign	ClinVar Orphanet	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
CONGENITAL NON-BULLOUS ICHTHYOSIFORM ERYTHRODERMA	—	GenCC	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Familial cancer of breast	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ICHTHYOSES	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ichthyosis and erythrokeratoderma	Conflicting classifications of pathogenicity	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATIC NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Alopecia	Alopecia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Chronic otitis media	Otitis media	HPO_DG			★☆☆☆☆ Found in Text Mining only
Collodion Fetus	Congenital Ichthyosis	CTD_human_DG	21739938		★☆☆☆☆ Found in Text Mining only
Congenital ichthyosis	Congenital Ichthyosis	BEFREE	15629692, 16116617, 17608720, 19131948, 23954555, 26298204, 26578203		★☆☆☆☆ Found in Text Mining only
Congenital ichthyosis	Congenital Ichthyosis	CTD_human_DG	21739938		★☆☆☆☆ Found in Text Mining only
Congenital non-bullous ichthyosiform erythroderma	Congenital Nonbullous Ichthyosiform Erythroderma	Orphanet			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Congenital Nonbullous Ichthyosiform Erythroderma	Congenital Nonbullous Ichthyosiform Erythroderma	ORPHANET_DG	12780701, 19131948, 21668430, 25423909		★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Congenital Nonbullous Ichthyosiform Erythroderma	Congenital Nonbullous Ichthyosiform Erythroderma	BEFREE	17608720, 18086569, 19131948, 23954555, 26578203		★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Congenital Nonbullous Ichthyosiform Erythroderma	Congenital Nonbullous Ichthyosiform Erythroderma	CTD_human_DG	21739938		★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Congenital Nonbullous Ichthyosiform Erythroderma	Congenital Nonbullous Ichthyosiform Erythroderma	HPO_DG			★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Corneal erosion	Corneal erosion	HPO_DG			★☆☆☆☆ Found in Text Mining only
Dwarfism	Dwarfism	HPO_DG			★☆☆☆☆ Found in Text Mining only
Ectropion	Ectropion	HPO_DG			★☆☆☆☆ Found in Text Mining only
Exfoliative dermatitis	Exfoliative Dermatitis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	30135298		★☆☆☆☆ Found in Text Mining only
Gangrene	Gangrene	HPO_DG			★☆☆☆☆ Found in Text Mining only
Harlequin Fetus	Harlequin Ichthyosis	CTD_human_DG	21739938		★☆☆☆☆ Found in Text Mining only
Hyperkeratosis	Hyperkeratosis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Hyperkeratosis Epidermolytic	Epidermolytic hyperkeratosis	Pubtator	26370990, 29935003	Associate	★☆☆☆☆ Found in Text Mining only
Hyperkeratosis, Epidermolytic	Hyperkeratosis, Epidermolytic	BEFREE	26370990, 29935003		★☆☆☆☆ Found in Text Mining only
Hypohidrosis	Hypohidrosis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Hypotrichosis	Hypotrichosis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Ichthyoses	Ichthyosis	BEFREE	15629692, 16116617, 26298204		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ichthyoses	Ichthyosis	CLINVAR_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ichthyoses	Ichthyosis	HPO_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ichthyosiform Erythroderma Congenital	Congenital ichthyosiform erythroderma	Pubtator	27025581	Associate	★☆☆☆☆ Found in Text Mining only
Ichthyosiform Erythroderma, Congenital	Ichthyosis Congenita	LHGDN	11773004, 15629692		★☆☆☆☆ Found in Text Mining only
Ichthyosiform Erythroderma, Congenital	Ichthyosis Congenita	BEFREE	17608720, 19131948, 21668430, 23954555, 26578203		★☆☆☆☆ Found in Text Mining only
Ichthyosiform Erythroderma, Congenital	Ichthyosis Congenita	HPO_DG			★☆☆☆☆ Found in Text Mining only
ICHTHYOSIFORM ERYTHRODERMA, CONGENITAL, NONBULLOUS, 1	CONGENITAL NONBULLOUS ICHTHYOSIFORM ERYTHRODERMA	CTD_human_DG			★☆☆☆☆ Found in Text Mining only
Ichthyosis	Ichthyosis	Pubtator	27025581	Associate	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Ichthyosis Congenita I	Ichthyosis Congenita	CTD_human_DG	21739938		★☆☆☆☆ Found in Text Mining only
Ichthyosis Congenita II	Ichthyosis Congenita	CTD_human_DG	21739938		★☆☆☆☆ Found in Text Mining only
ICHTHYOSIS, CONGENITAL, AUTOSOMAL RECESSIVE 2	Ichthyosis with hypotrichosis	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
ICHTHYOSIS, CONGENITAL, AUTOSOMAL RECESSIVE 3	Ichthyosis with hypotrichosis	UNIPROT_DG	11773004, 15629692, 16116617, 19131948, 19890349		★☆☆☆☆ Found in Text Mining only
ICHTHYOSIS, CONGENITAL, AUTOSOMAL RECESSIVE 3	Ichthyosis with hypotrichosis	CLINVAR_DG	16116617, 19131948, 19890349, 25998749		★☆☆☆☆ Found in Text Mining only
ICHTHYOSIS, CONGENITAL, AUTOSOMAL RECESSIVE 3	Ichthyosis with hypotrichosis	GENOMICS_ENGLAND_DG			★☆☆☆☆ Found in Text Mining only
ICHTHYOSIS, LAMELLAR, 5	Lamellar ichthyosis	CTD_human_DG			★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	HPO_DG			★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	HPO_DG			★☆☆☆☆ Found in Text Mining only
Keratitis	Keratitis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Keratoderma, Palmoplantar	Palmoplantar keratoderma	HPO_DG			★☆☆☆☆ Found in Text Mining only
Lamellar ichthyosis	Lamellar ichthyosis	Orphanet			★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Lamellar ichthyosis type 3	Lamellar ichthyosis	Pubtator	17139268, 19131948, 26578203, 30600594	Associate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	CTD_human_DG	22919386		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	30678711		★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	30135298		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	30135298		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	30678711		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	CTD_human_DG	22919386		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	30678711	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Renal Insufficiency	Renal Insufficiency	HPO_DG			★☆☆☆☆ Found in Text Mining only
Self-Healing Collodion Baby	Self-Healing Collodion Baby	ORPHANET_DG	19890349		★☆☆☆☆ Found in Text Mining only
Self-improving collodion baby	Self-Healing Collodion Baby	Orphanet			★☆☆☆☆ Found in Text Mining only
Skin Diseases	Skin disease	Pubtator	26370990, 29130490	Associate	★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	30135298		★☆☆☆☆ Found in Text Mining only