Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	59343
Gene name	SUMO specific peptidase 2
Gene symbol	SENP2
Synonyms (NCBI Gene)	AXAM2SMT3IP2
Chromosome	3
Chromosome location	3q27.2
Summary	SUMO1 (UBL1; MIM 601912) is a small ubiquitin-like protein that can be covalently conjugated to other proteins. SENP2 is one of a group of enzymes that process newly synthesized SUMO1 into the conjugatable form and catalyze the deconjugation of SUMO1-cont

287

Show/Hide all (287)

miRTarBase ID	miRNA	Experiments	Reference
MIRT027689	hsa-miR-98-5p	Microarray	19088304
MIRT047781	hsa-miR-30d-5p	CLASH	23622248
MIRT1335729	hsa-let-7a	CLIP-seq
MIRT1335730	hsa-let-7b	CLIP-seq
MIRT1335731	hsa-let-7c	CLIP-seq
MIRT1335732	hsa-let-7d	CLIP-seq
MIRT1335733	hsa-let-7e	CLIP-seq
MIRT1335734	hsa-let-7f	CLIP-seq
MIRT1335735	hsa-let-7g	CLIP-seq
MIRT1335736	hsa-let-7i	CLIP-seq
MIRT1335737	hsa-miR-132	CLIP-seq
MIRT1335738	hsa-miR-142-3p	CLIP-seq
MIRT1335739	hsa-miR-1972	CLIP-seq
MIRT1335740	hsa-miR-202	CLIP-seq
MIRT1335741	hsa-miR-203	CLIP-seq
MIRT1335742	hsa-miR-212	CLIP-seq
MIRT1335743	hsa-miR-3130-3p	CLIP-seq
MIRT1335744	hsa-miR-3194-5p	CLIP-seq
MIRT1335745	hsa-miR-3613-3p	CLIP-seq
MIRT1335746	hsa-miR-3688-3p	CLIP-seq
MIRT1335747	hsa-miR-3691-3p	CLIP-seq
MIRT1335748	hsa-miR-3692	CLIP-seq
MIRT1335749	hsa-miR-3921	CLIP-seq
MIRT1335750	hsa-miR-3940-5p	CLIP-seq
MIRT1335751	hsa-miR-4276	CLIP-seq
MIRT1335752	hsa-miR-4436a	CLIP-seq
MIRT1335753	hsa-miR-4458	CLIP-seq
MIRT1335754	hsa-miR-4494	CLIP-seq
MIRT1335755	hsa-miR-4500	CLIP-seq
MIRT1335756	hsa-miR-4507	CLIP-seq
MIRT1335757	hsa-miR-455-3p	CLIP-seq
MIRT1335758	hsa-miR-4650-5p	CLIP-seq
MIRT1335759	hsa-miR-4653-5p	CLIP-seq
MIRT1335760	hsa-miR-4659a-3p	CLIP-seq
MIRT1335761	hsa-miR-4659b-3p	CLIP-seq
MIRT1335762	hsa-miR-4677-3p	CLIP-seq
MIRT1335763	hsa-miR-4679	CLIP-seq
MIRT1335764	hsa-miR-4687-5p	CLIP-seq
MIRT1335765	hsa-miR-4719	CLIP-seq
MIRT1335766	hsa-miR-4759	CLIP-seq
MIRT1335767	hsa-miR-4766-5p	CLIP-seq
MIRT1335768	hsa-miR-4793-3p	CLIP-seq
MIRT1335769	hsa-miR-488	CLIP-seq
MIRT1335770	hsa-miR-499a-5p	CLIP-seq
MIRT1335771	hsa-miR-513a-3p	CLIP-seq
MIRT1335772	hsa-miR-520d-5p	CLIP-seq
MIRT1335773	hsa-miR-524-5p	CLIP-seq
MIRT1335774	hsa-miR-548an	CLIP-seq
MIRT1335775	hsa-miR-617	CLIP-seq
MIRT1335776	hsa-miR-654-3p	CLIP-seq
MIRT1335777	hsa-miR-98	CLIP-seq
MIRT2099264	hsa-miR-1226	CLIP-seq
MIRT2099265	hsa-miR-1261	CLIP-seq
MIRT2099266	hsa-miR-129-5p	CLIP-seq
MIRT2099267	hsa-miR-18a	CLIP-seq
MIRT2099268	hsa-miR-18b	CLIP-seq
MIRT2099269	hsa-miR-1976	CLIP-seq
MIRT2099270	hsa-miR-214	CLIP-seq
MIRT2099271	hsa-miR-28-3p	CLIP-seq
MIRT2099272	hsa-miR-3074-3p	CLIP-seq
MIRT2099273	hsa-miR-3121-3p	CLIP-seq
MIRT2099274	hsa-miR-3133	CLIP-seq
MIRT2099275	hsa-miR-3143	CLIP-seq
MIRT2099276	hsa-miR-3180-5p	CLIP-seq
MIRT1335745	hsa-miR-3613-3p	CLIP-seq
MIRT2099277	hsa-miR-3619-5p	CLIP-seq
MIRT2099278	hsa-miR-3622a-5p	CLIP-seq
MIRT1335748	hsa-miR-3692	CLIP-seq
MIRT2099279	hsa-miR-370	CLIP-seq
MIRT2099280	hsa-miR-371b-5p	CLIP-seq
MIRT1335749	hsa-miR-3921	CLIP-seq
MIRT2099281	hsa-miR-3942-3p	CLIP-seq
MIRT2099282	hsa-miR-4269	CLIP-seq
MIRT2099283	hsa-miR-4270	CLIP-seq
MIRT1335751	hsa-miR-4276	CLIP-seq
MIRT2099284	hsa-miR-4291	CLIP-seq
MIRT2099285	hsa-miR-4303	CLIP-seq
MIRT2099286	hsa-miR-4310	CLIP-seq
MIRT2099287	hsa-miR-4423-3p	CLIP-seq
MIRT2099288	hsa-miR-4441	CLIP-seq
MIRT2099289	hsa-miR-4468	CLIP-seq
MIRT2099290	hsa-miR-4477b	CLIP-seq
MIRT2099291	hsa-miR-4530	CLIP-seq
MIRT1335759	hsa-miR-4653-5p	CLIP-seq
MIRT1335760	hsa-miR-4659a-3p	CLIP-seq
MIRT1335761	hsa-miR-4659b-3p	CLIP-seq
MIRT2099292	hsa-miR-4690-5p	CLIP-seq
MIRT1335765	hsa-miR-4719	CLIP-seq
MIRT2099293	hsa-miR-4735-3p	CLIP-seq
MIRT2099294	hsa-miR-4753-3p	CLIP-seq
MIRT1335771	hsa-miR-513a-3p	CLIP-seq
MIRT2099295	hsa-miR-518a-5p	CLIP-seq
MIRT2099296	hsa-miR-520a-5p	CLIP-seq
MIRT2099297	hsa-miR-525-5p	CLIP-seq
MIRT2099298	hsa-miR-527	CLIP-seq
MIRT2099299	hsa-miR-543	CLIP-seq
MIRT2099300	hsa-miR-548b-3p	CLIP-seq
MIRT2099301	hsa-miR-634	CLIP-seq
MIRT2099302	hsa-miR-646	CLIP-seq
MIRT2099303	hsa-miR-759	CLIP-seq
MIRT2099304	hsa-miR-761	CLIP-seq
MIRT2099305	hsa-miR-802	CLIP-seq
MIRT2099306	hsa-miR-885-3p	CLIP-seq
MIRT2099307	hsa-miR-888	CLIP-seq
MIRT2099308	hsa-miR-922	CLIP-seq
MIRT2323994	hsa-miR-1208	CLIP-seq
MIRT2099264	hsa-miR-1226	CLIP-seq
MIRT2323995	hsa-miR-1227	CLIP-seq
MIRT2323996	hsa-miR-1273d	CLIP-seq
MIRT1335737	hsa-miR-132	CLIP-seq
MIRT2323997	hsa-miR-145	CLIP-seq
MIRT2323998	hsa-miR-146a	CLIP-seq
MIRT2323999	hsa-miR-146b-5p	CLIP-seq
MIRT2324000	hsa-miR-147	CLIP-seq
MIRT2324001	hsa-miR-1470	CLIP-seq
MIRT2099267	hsa-miR-18a	CLIP-seq
MIRT2099268	hsa-miR-18b	CLIP-seq
MIRT2324002	hsa-miR-1909	CLIP-seq
MIRT2324003	hsa-miR-197	CLIP-seq
MIRT1335739	hsa-miR-1972	CLIP-seq
MIRT2099269	hsa-miR-1976	CLIP-seq
MIRT1335742	hsa-miR-212	CLIP-seq
MIRT2099270	hsa-miR-214	CLIP-seq
MIRT2324004	hsa-miR-224	CLIP-seq
MIRT2099271	hsa-miR-28-3p	CLIP-seq
MIRT2099274	hsa-miR-3133	CLIP-seq
MIRT1335744	hsa-miR-3194-5p	CLIP-seq
MIRT2324005	hsa-miR-361-3p	CLIP-seq
MIRT2099277	hsa-miR-3619-5p	CLIP-seq
MIRT2099278	hsa-miR-3622a-5p	CLIP-seq
MIRT2324006	hsa-miR-3646	CLIP-seq
MIRT1335747	hsa-miR-3691-3p	CLIP-seq
MIRT2099279	hsa-miR-370	CLIP-seq
MIRT2324007	hsa-miR-3911	CLIP-seq
MIRT1335749	hsa-miR-3921	CLIP-seq
MIRT1335750	hsa-miR-3940-5p	CLIP-seq
MIRT2099282	hsa-miR-4269	CLIP-seq
MIRT2099284	hsa-miR-4291	CLIP-seq
MIRT2099285	hsa-miR-4303	CLIP-seq
MIRT2099287	hsa-miR-4423-3p	CLIP-seq
MIRT2324008	hsa-miR-4436b-5p	CLIP-seq
MIRT2099289	hsa-miR-4468	CLIP-seq
MIRT2099290	hsa-miR-4477b	CLIP-seq
MIRT2324009	hsa-miR-4480	CLIP-seq
MIRT1335756	hsa-miR-4507	CLIP-seq
MIRT2099291	hsa-miR-4530	CLIP-seq
MIRT1335757	hsa-miR-455-3p	CLIP-seq
MIRT2324010	hsa-miR-4649-3p	CLIP-seq
MIRT1335758	hsa-miR-4650-5p	CLIP-seq
MIRT1335759	hsa-miR-4653-5p	CLIP-seq
MIRT2324011	hsa-miR-4667-3p	CLIP-seq
MIRT1335762	hsa-miR-4677-3p	CLIP-seq
MIRT1335764	hsa-miR-4687-5p	CLIP-seq
MIRT2099292	hsa-miR-4690-5p	CLIP-seq
MIRT2324012	hsa-miR-4693-3p	CLIP-seq
MIRT2324013	hsa-miR-4704-5p	CLIP-seq
MIRT2324014	hsa-miR-4709-3p	CLIP-seq
MIRT2324015	hsa-miR-4727-5p	CLIP-seq
MIRT2099293	hsa-miR-4735-3p	CLIP-seq
MIRT2099294	hsa-miR-4753-3p	CLIP-seq
MIRT1335767	hsa-miR-4766-5p	CLIP-seq
MIRT2324016	hsa-miR-4769-3p	CLIP-seq
MIRT2324017	hsa-miR-4773	CLIP-seq
MIRT1335769	hsa-miR-488	CLIP-seq
MIRT2324018	hsa-miR-499-3p	CLIP-seq
MIRT2324019	hsa-miR-499a-3p	CLIP-seq
MIRT1335771	hsa-miR-513a-3p	CLIP-seq
MIRT2099295	hsa-miR-518a-5p	CLIP-seq
MIRT1335772	hsa-miR-520d-5p	CLIP-seq
MIRT1335773	hsa-miR-524-5p	CLIP-seq
MIRT2099298	hsa-miR-527	CLIP-seq
MIRT1335774	hsa-miR-548an	CLIP-seq
MIRT2099300	hsa-miR-548b-3p	CLIP-seq
MIRT2324020	hsa-miR-556-3p	CLIP-seq
MIRT2324021	hsa-miR-581	CLIP-seq
MIRT2324022	hsa-miR-589	CLIP-seq
MIRT2099301	hsa-miR-634	CLIP-seq
MIRT2324023	hsa-miR-642a	CLIP-seq
MIRT2324024	hsa-miR-644	CLIP-seq
MIRT2099302	hsa-miR-646	CLIP-seq
MIRT2324025	hsa-miR-718	CLIP-seq
MIRT2099304	hsa-miR-761	CLIP-seq
MIRT2099308	hsa-miR-922	CLIP-seq
MIRT2324026	hsa-miR-935	CLIP-seq
MIRT1335729	hsa-let-7a	CLIP-seq
MIRT1335730	hsa-let-7b	CLIP-seq
MIRT1335731	hsa-let-7c	CLIP-seq
MIRT1335732	hsa-let-7d	CLIP-seq
MIRT1335733	hsa-let-7e	CLIP-seq
MIRT1335734	hsa-let-7f	CLIP-seq
MIRT1335735	hsa-let-7g	CLIP-seq
MIRT1335736	hsa-let-7i	CLIP-seq
MIRT2619877	hsa-miR-122	CLIP-seq
MIRT2619878	hsa-miR-1260	CLIP-seq
MIRT2619879	hsa-miR-1260b	CLIP-seq
MIRT2323996	hsa-miR-1273d	CLIP-seq
MIRT2323998	hsa-miR-146a	CLIP-seq
MIRT2323999	hsa-miR-146b-5p	CLIP-seq
MIRT2324000	hsa-miR-147	CLIP-seq
MIRT2619880	hsa-miR-181a	CLIP-seq
MIRT2619881	hsa-miR-181b	CLIP-seq
MIRT2619882	hsa-miR-181c	CLIP-seq
MIRT2619883	hsa-miR-181d	CLIP-seq
MIRT2619884	hsa-miR-186	CLIP-seq
MIRT2619885	hsa-miR-188-3p	CLIP-seq
MIRT2324002	hsa-miR-1909	CLIP-seq
MIRT1335740	hsa-miR-202	CLIP-seq
MIRT2619886	hsa-miR-2116	CLIP-seq
MIRT2619887	hsa-miR-216b	CLIP-seq
MIRT2619888	hsa-miR-2277-3p	CLIP-seq
MIRT2619889	hsa-miR-27a	CLIP-seq
MIRT2619890	hsa-miR-27b	CLIP-seq
MIRT2619891	hsa-miR-3150a-3p	CLIP-seq
MIRT2619892	hsa-miR-3156-3p	CLIP-seq
MIRT1335748	hsa-miR-3692	CLIP-seq
MIRT2619893	hsa-miR-375	CLIP-seq
MIRT2619894	hsa-miR-376a	CLIP-seq
MIRT2619895	hsa-miR-376b	CLIP-seq
MIRT2619896	hsa-miR-4262	CLIP-seq
MIRT2619897	hsa-miR-4273	CLIP-seq
MIRT1335751	hsa-miR-4276	CLIP-seq
MIRT2619898	hsa-miR-4450	CLIP-seq
MIRT1335753	hsa-miR-4458	CLIP-seq
MIRT2619899	hsa-miR-4474-5p	CLIP-seq
MIRT2324009	hsa-miR-4480	CLIP-seq
MIRT1335755	hsa-miR-4500	CLIP-seq
MIRT2619900	hsa-miR-4534	CLIP-seq
MIRT1335760	hsa-miR-4659a-3p	CLIP-seq
MIRT1335761	hsa-miR-4659b-3p	CLIP-seq
MIRT2619901	hsa-miR-4668-5p	CLIP-seq
MIRT1335762	hsa-miR-4677-3p	CLIP-seq
MIRT2619902	hsa-miR-4677-5p	CLIP-seq
MIRT1335765	hsa-miR-4719	CLIP-seq
MIRT2324017	hsa-miR-4773	CLIP-seq
MIRT2619903	hsa-miR-4797-3p	CLIP-seq
MIRT2619904	hsa-miR-491-5p	CLIP-seq
MIRT2619905	hsa-miR-495	CLIP-seq
MIRT1335771	hsa-miR-513a-3p	CLIP-seq
MIRT2619906	hsa-miR-513a-5p	CLIP-seq
MIRT2619907	hsa-miR-578	CLIP-seq
MIRT2324021	hsa-miR-581	CLIP-seq
MIRT2324022	hsa-miR-589	CLIP-seq
MIRT2619908	hsa-miR-605	CLIP-seq
MIRT2619909	hsa-miR-939	CLIP-seq
MIRT1335777	hsa-miR-98	CLIP-seq
MIRT2619877	hsa-miR-122	CLIP-seq
MIRT2619878	hsa-miR-1260	CLIP-seq
MIRT2619879	hsa-miR-1260b	CLIP-seq
MIRT2323996	hsa-miR-1273d	CLIP-seq
MIRT2323998	hsa-miR-146a	CLIP-seq
MIRT2323999	hsa-miR-146b-5p	CLIP-seq
MIRT2619880	hsa-miR-181a	CLIP-seq
MIRT2619881	hsa-miR-181b	CLIP-seq
MIRT2619882	hsa-miR-181c	CLIP-seq
MIRT2619883	hsa-miR-181d	CLIP-seq
MIRT2619884	hsa-miR-186	CLIP-seq
MIRT2619885	hsa-miR-188-3p	CLIP-seq
MIRT2324002	hsa-miR-1909	CLIP-seq
MIRT2619887	hsa-miR-216b	CLIP-seq
MIRT2619888	hsa-miR-2277-3p	CLIP-seq
MIRT2619889	hsa-miR-27a	CLIP-seq
MIRT2619890	hsa-miR-27b	CLIP-seq
MIRT2619891	hsa-miR-3150a-3p	CLIP-seq
MIRT2619892	hsa-miR-3156-3p	CLIP-seq
MIRT1335748	hsa-miR-3692	CLIP-seq
MIRT2619894	hsa-miR-376a	CLIP-seq
MIRT2619895	hsa-miR-376b	CLIP-seq
MIRT2619896	hsa-miR-4262	CLIP-seq
MIRT1335751	hsa-miR-4276	CLIP-seq
MIRT2619898	hsa-miR-4450	CLIP-seq
MIRT2619899	hsa-miR-4474-5p	CLIP-seq
MIRT2324009	hsa-miR-4480	CLIP-seq
MIRT2619900	hsa-miR-4534	CLIP-seq
MIRT1335760	hsa-miR-4659a-3p	CLIP-seq
MIRT1335761	hsa-miR-4659b-3p	CLIP-seq
MIRT2619901	hsa-miR-4668-5p	CLIP-seq
MIRT1335762	hsa-miR-4677-3p	CLIP-seq
MIRT1335765	hsa-miR-4719	CLIP-seq
MIRT2324017	hsa-miR-4773	CLIP-seq
MIRT2619903	hsa-miR-4797-3p	CLIP-seq
MIRT2619904	hsa-miR-491-5p	CLIP-seq
MIRT2619905	hsa-miR-495	CLIP-seq
MIRT1335771	hsa-miR-513a-3p	CLIP-seq
MIRT2619906	hsa-miR-513a-5p	CLIP-seq
MIRT2324022	hsa-miR-589	CLIP-seq
MIRT2619908	hsa-miR-605	CLIP-seq
MIRT2619909	hsa-miR-939	CLIP-seq

Show/Hide all (45)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	11896061, 15296745, 17099700, 20098747, 21965678, 25416956, 32296183, 33961781
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005643	Component	Nuclear pore	IDA	12192048
GO:0005643	Component	Nuclear pore	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA
GO:0006508	Process	Proteolysis	IEA
GO:0007507	Process	Heart development	IEA
GO:0008233	Function	Peptidase activity	IEA
GO:0008234	Function	Cysteine-type peptidase activity	IEA
GO:0015031	Process	Protein transport	IEA
GO:0016020	Component	Membrane	IEA
GO:0016055	Process	Wnt signaling pathway	IEA
GO:0016604	Component	Nuclear body	IEA
GO:0016605	Component	PML body	IEA
GO:0016605	Component	PML body	ISS
GO:0016787	Function	Hydrolase activity	IEA
GO:0016925	Process	Protein sumoylation	IEA
GO:0016925	Process	Protein sumoylation	TAS
GO:0016926	Process	Protein desumoylation	IBA
GO:0016926	Process	Protein desumoylation	IDA	20194620
GO:0016926	Process	Protein desumoylation	IEA
GO:0016926	Process	Protein desumoylation	IMP	21965678, 22028379
GO:0016929	Function	DeSUMOylase activity	IBA
GO:0016929	Function	DeSUMOylase activity	IEA
GO:0030111	Process	Regulation of Wnt signaling pathway	NAS	11896061
GO:0031397	Process	Negative regulation of protein ubiquitination	IDA	22028379
GO:0031398	Process	Positive regulation of protein ubiquitination	IMP	22028379
GO:0031648	Process	Protein destabilization	IMP	22028379
GO:0031965	Component	Nuclear membrane	IEA
GO:0032875	Process	Regulation of DNA endoreduplication	IEA
GO:0045444	Process	Fat cell differentiation	IEA
GO:0045444	Process	Fat cell differentiation	ISS
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0051028	Process	MRNA transport	IEA
GO:0060255	Process	Regulation of macromolecule metabolic process	IEA
GO:0060707	Process	Trophoblast giant cell differentiation	IEA
GO:0060711	Process	Labyrinthine layer development	IEA
GO:0070139	Function	SUMO-specific endopeptidase activity	EXP	16608850, 17591783
GO:0070139	Function	SUMO-specific endopeptidase activity	IDA	11896061
GO:0070139	Function	SUMO-specific endopeptidase activity	IEA
GO:0080090	Process	Regulation of primary metabolic process	IEA
GO:2000045	Process	Regulation of G1/S transition of mitotic cell cycle	IEA

MIM	HGNC	e!Ensembl
608261	23116	ENSG00000163904

Q9HC62

Protein name

Sentrin-specific protease 2 (EC 3.4.22.-) (Axam2) (SMT3-specific isopeptidase 2) (Smt3ip2) (Sentrin/SUMO-specific protease SENP2)

Protein function

Protease that catalyzes two essential functions in the SUMO pathway (PubMed:11896061, PubMed:12192048, PubMed:15296745, PubMed:20194620, PubMed:21965678). The first is the hydrolysis of an alpha-linked peptide bond at the C-terminal end of the s

PDB

1TGZ , 1TH0 , 2IO0 , 2IO1 , 2IO2 , 2IO3 , 3ZO5 , 5AEK

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF02902	Peptidase_C48	409 → 588	Ulp1 protease family, C-terminal catalytic domain	Domain

Sequence

MYRWLVRILGTIFRFCDRSVPPARALLKRRRSDSTLFSTVDTDEIPAKRPRLDCFIHQVK
NSLYNAASLFGFPFQLTTKPMVTSACNGTRNVAPSGEVFSNSSSCELTGSGSWNNMLKLG
NKSPNGISDYPKIRVTVTRDQPRRVLPSFGFTLNSEGCNRRPGGRRHSKGNPESSLMWKP
QEQAVTEMISEESGKGLRRPHCTVEEGVQKEEREKYRKLLERLKESGHGNSVCPVTSNYH
SSQRSQMDTLKTKGWGEEQNHGVKTTQFVPKQYRLVETRGPLCSLRSEKRCSKGKITDTE
TMVGIRFENESRRGYQLEPDLSEEVSARLRLGSGSNGLLRRKVSIIETKEKNCSGKERDR
RTDDLLELTEDMEKEISNALGHGPQDEILSSAFKLRITRGDIQTLKNYHWLNDEVINFYM
NLLVERNKKQGYPALHVFSTFFYPKLKSGGYQAVKRWTKGVNLFEQEIILVPIHRKVHWS
LVVIDLRKKCLKYLDSMGQKGHRICEILLQYLQDESKTKRNSDLNLLEWTHHSMKPHEIP
QQLNGSDCGMFTCKYADYISRDKPITFTQHQMPLFRKKMVWEILHQQLL

Sequence length

589

Interactions

View interactions

	KEGG		Reactome
	Nucleocytoplasmic transport Wnt signaling pathway		SUMO is proteolytically processed

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (9)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Acute myeloid leukemia	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATRIOVENTRICULAR BLOCK	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLOR VISION DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GOUT	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SEBORRHEIC DERMATITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SEIZURES	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (34)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Arteriosclerosis	Arteriosclerosis	BEFREE	29969578		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	29969578		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	24008762, 26369384, 28574613		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	27178176, 30638182, 30732133		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	24422630, 27178176, 29955155, 30732133	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	29955155	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	23098437, 24969559	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	24008762, 26369384, 28574613		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	24004673	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	BEFREE	22155005		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	30431078		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital anomaly of brain	Brain malformation	BEFREE	31625212		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital Heart Defects	Congenital heart defects	BEFREE	22155005		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	22155005		★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	31372032		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	GWASCAT_DG	29632382		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	29535048		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	30612578	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	23098437, 30542495		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	30732133	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
MAJOR AFFECTIVE DISORDER 2	Major Affective Disorder	BEFREE	29535048		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	27178176, 30638182, 30732133		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	24008762, 26369384, 28574613		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	29955155, 30431078		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	25784542		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	31964975	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	28574613, 29060933, 30431078, 30542495		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	29969578		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	25784542, 29272473		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	30542495		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	29060933	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	29955155		★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	24008762, 26369384	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ventricular Septal Defects	Ventricular septal defect	BEFREE	22155005		★★★★★ ★☆☆☆☆ Found in Text Mining only

SENP2 (SUMO specific peptidase 2)