SCPEP1 (serine carboxypeptidase 1)

Gene

• Entrez ID: 59342
• Gene name: Serine carboxypeptidase 1
• Gene symbol: SCPEP1
• Synonyms (NCBI Gene): HSCP1, RISC
• Chromosome: 17
• Chromosome location: 17q22

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT1330611	hsa-miR-1184	CLIP-seq
MIRT1330612	hsa-miR-1205	CLIP-seq
MIRT1330613	hsa-miR-298	CLIP-seq
MIRT1330614	hsa-miR-3158-5p	CLIP-seq
MIRT1330615	hsa-miR-320e	CLIP-seq
MIRT1330616	hsa-miR-4793-5p	CLIP-seq
MIRT1330617	hsa-miR-501-5p	CLIP-seq
MIRT739051	hsa-miR-3189-5p	CLIP-seq
MIRT739054	hsa-miR-3925-3p	CLIP-seq
MIRT739052	hsa-miR-4323	CLIP-seq
MIRT739053	hsa-miR-766	CLIP-seq
MIRT739051	hsa-miR-3189-5p	CLIP-seq
MIRT2097873	hsa-miR-3924	CLIP-seq
MIRT739054	hsa-miR-3925-3p	CLIP-seq
MIRT739052	hsa-miR-4323	CLIP-seq
MIRT739053	hsa-miR-766	CLIP-seq
MIRT2618558	hsa-miR-190	CLIP-seq
MIRT2618559	hsa-miR-190b	CLIP-seq
MIRT2618560	hsa-miR-376c	CLIP-seq
MIRT2618561	hsa-miR-579	CLIP-seq
MIRT2618562	hsa-miR-664	CLIP-seq
MIRT2618558	hsa-miR-190	CLIP-seq
MIRT2618559	hsa-miR-190b	CLIP-seq
MIRT2618560	hsa-miR-376c	CLIP-seq
MIRT2618561	hsa-miR-579	CLIP-seq
MIRT2618562	hsa-miR-664	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004180	Function	Carboxypeptidase activity	IEA
GO:0004185	Function	Serine-type carboxypeptidase activity	IBA
GO:0004185	Function	Serine-type carboxypeptidase activity	IEA
GO:0004185	Function	Serine-type carboxypeptidase activity	ISS
GO:0005576	Component	Extracellular region	IEA
GO:0006508	Process	Proteolysis	IEA
GO:0008233	Function	Peptidase activity	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0042573	Process	Retinoic acid metabolic process	ISS
GO:0045776	Process	Negative regulation of blood pressure	IEA
GO:0045776	Process	Negative regulation of blood pressure	ISS
GO:0065008	Process	Regulation of biological quality	IEA
GO:0070062	Component	Extracellular exosome	HDA	19056867, 19199708, 23533145
GO:0097746	Process	Blood vessel diameter maintenance	IEA
GO:0097746	Process	Blood vessel diameter maintenance	ISS

Other IDs

• MIM: 619723
• HGNC: 29507
• e!Ensembl: ENSG00000121064

Protein

• UniProt ID: Q9HB40
• Protein name: Retinoid-inducible serine carboxypeptidase (EC 3.4.16.-) (Serine carboxypeptidase 1)
• Protein function: May be involved in vascular wall and kidney homeostasis.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00450	Peptidase_S10	29 → 451	Serine carboxypeptidase	Domain

• Sequence:

  MELALRRSPVPRWLLLLPLLLGLNAGAVIDWPTEEGKEVWDYVTVRKDAYMFWWLYYATN
  SCKNFSELPLVMWLQGGPGGSSTGFGNFEEIGPLDSDLKPRKTTWLQAASLLFVDNPVGT
  GFSYVNGSGAYAKDLAMVASDMMVLLKTFFSCHKEFQTVPFYIFSESYGGKMAAGIGLEL
  YKAIQRGTIKCNFAGVALGDSWISPVDSVLSWGPYLYSMSLLEDKGLAEVSKVAEQVLNA
  VNKGLYREATELWGKAEMIIEQNTDGVNFYNILTKSTPTSTMESSLEFTQSHLVCLCQRH
  VRHLQRDALSQLMNGPIRKKLKIIPEDQSWGGQATNVFVNMEEDFMKPVISIVDELLEAG
  INVTVYNGQLDLIVDTMGQEAWVRKLKWPELPKFSQLKWKALYSDPKSLETSAFVKSYKN
  LAFYWILKAGHMVPSDQGDMALKMMRLVTQQE

• Sequence length: 452

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
Cervical cancer	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLAUCOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Breast Carcinoma	Breast Carcinoma	BEFREE	24806942, 25446899		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	25293974		★☆☆☆☆ Found in Text Mining only
Depressive disorder	Mental Depression	BEFREE	31654919		★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	27334352		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	27334352		★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	30529353		★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	24586188, 27984413		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	10584877		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	28428278		★☆☆☆☆ Found in Text Mining only
Lymphoma, T-Cell, Cutaneous	Lymphoma	BEFREE	11149944, 11807795		★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	31654919		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	25446899		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	25893300		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of testis	Malignant Neoplasm Of Testis	BEFREE	14991579, 16094643		★☆☆☆☆ Found in Text Mining only
Mental Depression	Mental Depression	BEFREE	31654919		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	10584877		★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	10584877		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	11149944, 12584747, 25293974, 25893300, 28440748		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	25663449		★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	14991579		★☆☆☆☆ Found in Text Mining only
Pancreatitis, Chronic	Pancreatitis	BEFREE	14991579		★☆☆☆☆ Found in Text Mining only
Parapsoriasis	Parapsoriasis	BEFREE	11807795		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	16926102		★☆☆☆☆ Found in Text Mining only
SVEINSSON CHORIORETINAL ATROPHY	Sveinsson Chorioretinal Atrophy	BEFREE	28684768		★☆☆☆☆ Found in Text Mining only
Temporomandibular Joint Disorders	Temporomandibular Joint Disorders	BEFREE	29205436		★☆☆☆☆ Found in Text Mining only