RBL1 (RB transcriptional corepressor like 1)

Gene

• Entrez ID: 5933
• Gene name: RB transcriptional corepressor like 1
• Gene symbol: RBL1
• Synonyms (NCBI Gene): CP107, PRB1, p107
• Chromosome: 20
• Chromosome location: 20q11.23
• Summary: The protein encoded by this gene is similar in sequence and possibly function to the product of the retinoblastoma 1 (RB1) gene. The RB1 gene product is a tumor suppressor protein that appears to be involved in cell cycle regulation, as it is phosphorylat

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT005851	hsa-miR-17-5p	Luciferase reporter assay	21283765
MIRT005858	hsa-miR-20a-5p	Luciferase reporter assay	21283765
MIRT005866	hsa-miR-106b-5p	Luciferase reporter assay	21283765
MIRT005866	hsa-miR-106b-5p	Luciferase reporter assay	24166509
MIRT005866	hsa-miR-106b-5p	Luciferase reporter assay	24166509
MIRT005866	hsa-miR-106b-5p	Luciferase reporter assay	24166509
MIRT005866	hsa-miR-106b-5p	Luciferase reporter assay	24166509
MIRT005866	hsa-miR-106b-5p	Luciferase reporter assay	24166509
MIRT005866	hsa-miR-106b-5p	Luciferase reporter assay	24166509
MIRT005866	hsa-miR-106b-5p	Luciferase reporter assay	24166509
MIRT005866	hsa-miR-106b-5p	Luciferase reporter assay	24166509
MIRT666716	hsa-miR-6813-3p	HITS-CLIP	23824327
MIRT666715	hsa-miR-5693	HITS-CLIP	23824327
MIRT635344	hsa-miR-212-5p	HITS-CLIP	23824327
MIRT666714	hsa-miR-6499-3p	HITS-CLIP	23824327
MIRT666713	hsa-miR-504-3p	HITS-CLIP	23824327
MIRT666712	hsa-miR-122-5p	HITS-CLIP	23824327
MIRT666711	hsa-miR-6722-5p	HITS-CLIP	23824327
MIRT666710	hsa-miR-4284	HITS-CLIP	23824327
MIRT666709	hsa-miR-24-3p	HITS-CLIP	23824327
MIRT666708	hsa-miR-143-5p	HITS-CLIP	23824327
MIRT666707	hsa-miR-8057	HITS-CLIP	23824327
MIRT666706	hsa-miR-5698	HITS-CLIP	23824327
MIRT635350	hsa-miR-6507-3p	HITS-CLIP	23824327
MIRT635349	hsa-miR-6838-3p	HITS-CLIP	23824327
MIRT635348	hsa-miR-186-3p	HITS-CLIP	23824327
MIRT635347	hsa-miR-939-3p	HITS-CLIP	23824327
MIRT635346	hsa-miR-6852-5p	HITS-CLIP	23824327
MIRT635345	hsa-miR-6742-3p	HITS-CLIP	23824327
MIRT635344	hsa-miR-212-5p	HITS-CLIP	23824327
MIRT645545	hsa-miR-150-5p	HITS-CLIP	23824327
MIRT635343	hsa-miR-619-5p	HITS-CLIP	23824327
MIRT635342	hsa-miR-6506-5p	HITS-CLIP	23824327
MIRT635341	hsa-miR-4707-3p	HITS-CLIP	23824327
MIRT635340	hsa-miR-6778-3p	HITS-CLIP	23824327
MIRT635339	hsa-miR-4757-5p	HITS-CLIP	23824327
MIRT635338	hsa-miR-6744-3p	HITS-CLIP	23824327
MIRT635337	hsa-miR-1343-3p	HITS-CLIP	23824327
MIRT635336	hsa-miR-6783-3p	HITS-CLIP	23824327
MIRT635335	hsa-miR-6878-3p	HITS-CLIP	23824327
MIRT635334	hsa-miR-5089-5p	HITS-CLIP	23824327
MIRT635350	hsa-miR-6507-3p	HITS-CLIP	23824327
MIRT635349	hsa-miR-6838-3p	HITS-CLIP	23824327
MIRT635348	hsa-miR-186-3p	HITS-CLIP	23824327
MIRT635347	hsa-miR-939-3p	HITS-CLIP	23824327
MIRT635346	hsa-miR-6852-5p	HITS-CLIP	23824327
MIRT635345	hsa-miR-6742-3p	HITS-CLIP	23824327
MIRT635344	hsa-miR-212-5p	HITS-CLIP	23824327
MIRT635343	hsa-miR-619-5p	HITS-CLIP	23824327
MIRT635342	hsa-miR-6506-5p	HITS-CLIP	23824327
MIRT635341	hsa-miR-4707-3p	HITS-CLIP	23824327
MIRT635340	hsa-miR-6778-3p	HITS-CLIP	23824327
MIRT635339	hsa-miR-4757-5p	HITS-CLIP	23824327
MIRT635338	hsa-miR-6744-3p	HITS-CLIP	23824327
MIRT635337	hsa-miR-1343-3p	HITS-CLIP	23824327
MIRT635336	hsa-miR-6783-3p	HITS-CLIP	23824327
MIRT635335	hsa-miR-6878-3p	HITS-CLIP	23824327
MIRT635334	hsa-miR-5089-5p	HITS-CLIP	23824327
MIRT572723	hsa-miR-193a-3p	PAR-CLIP	20371350
MIRT572722	hsa-miR-193b-3p	PAR-CLIP	20371350
MIRT572721	hsa-miR-892b	PAR-CLIP	20371350
MIRT572720	hsa-miR-646	PAR-CLIP	20371350
MIRT572719	hsa-miR-22-3p	PAR-CLIP	20371350
MIRT572718	hsa-miR-6882-3p	PAR-CLIP	20371350
MIRT572717	hsa-miR-6815-3p	PAR-CLIP	20371350
MIRT496142	hsa-miR-1910-3p	PAR-CLIP	22291592
MIRT496141	hsa-miR-6511a-5p	PAR-CLIP	22291592
MIRT496140	hsa-miR-6808-5p	PAR-CLIP	22291592
MIRT496139	hsa-miR-6893-5p	PAR-CLIP	22291592
MIRT496138	hsa-miR-940	PAR-CLIP	22291592
MIRT496137	hsa-miR-2682-5p	PAR-CLIP	22291592
MIRT496136	hsa-miR-34b-5p	PAR-CLIP	22291592
MIRT496135	hsa-miR-449c-5p	PAR-CLIP	22291592
MIRT496134	hsa-miR-4717-5p	PAR-CLIP	22291592
MIRT496133	hsa-miR-4690-3p	PAR-CLIP	22291592
MIRT496132	hsa-miR-5685	PAR-CLIP	22291592
MIRT496131	hsa-miR-6806-5p	PAR-CLIP	22291592
MIRT445711	hsa-miR-3662	PAR-CLIP	22100165
MIRT445710	hsa-miR-3646	PAR-CLIP	22100165
MIRT445709	hsa-miR-526b-5p	PAR-CLIP	22100165
MIRT445708	hsa-miR-580-3p	PAR-CLIP	22100165
MIRT445711	hsa-miR-3662	PAR-CLIP	22100165
MIRT445710	hsa-miR-3646	PAR-CLIP	22100165
MIRT445709	hsa-miR-526b-5p	PAR-CLIP	22100165
MIRT445708	hsa-miR-580-3p	PAR-CLIP	22100165
MIRT666716	hsa-miR-6813-3p	HITS-CLIP	23824327
MIRT666715	hsa-miR-5693	HITS-CLIP	23824327
MIRT635344	hsa-miR-212-5p	HITS-CLIP	23824327
MIRT666714	hsa-miR-6499-3p	HITS-CLIP	23824327
MIRT666713	hsa-miR-504-3p	HITS-CLIP	23824327
MIRT666712	hsa-miR-122-5p	HITS-CLIP	23824327
MIRT666711	hsa-miR-6722-5p	HITS-CLIP	23824327
MIRT666710	hsa-miR-4284	HITS-CLIP	23824327
MIRT666709	hsa-miR-24-3p	HITS-CLIP	23824327
MIRT666708	hsa-miR-143-5p	HITS-CLIP	23824327
MIRT666707	hsa-miR-8057	HITS-CLIP	23824327
MIRT666706	hsa-miR-5698	HITS-CLIP	23824327
MIRT635350	hsa-miR-6507-3p	HITS-CLIP	23824327
MIRT635349	hsa-miR-6838-3p	HITS-CLIP	23824327
MIRT635348	hsa-miR-186-3p	HITS-CLIP	23824327
MIRT635347	hsa-miR-939-3p	HITS-CLIP	23824327
MIRT635346	hsa-miR-6852-5p	HITS-CLIP	23824327
MIRT635345	hsa-miR-6742-3p	HITS-CLIP	23824327
MIRT635344	hsa-miR-212-5p	HITS-CLIP	23824327
MIRT645545	hsa-miR-150-5p	HITS-CLIP	23824327
MIRT635343	hsa-miR-619-5p	HITS-CLIP	23824327
MIRT635342	hsa-miR-6506-5p	HITS-CLIP	23824327
MIRT635341	hsa-miR-4707-3p	HITS-CLIP	23824327
MIRT635340	hsa-miR-6778-3p	HITS-CLIP	23824327
MIRT635339	hsa-miR-4757-5p	HITS-CLIP	23824327
MIRT635338	hsa-miR-6744-3p	HITS-CLIP	23824327
MIRT635337	hsa-miR-1343-3p	HITS-CLIP	23824327
MIRT635336	hsa-miR-6783-3p	HITS-CLIP	23824327
MIRT635335	hsa-miR-6878-3p	HITS-CLIP	23824327
MIRT635334	hsa-miR-5089-5p	HITS-CLIP	23824327
MIRT635350	hsa-miR-6507-3p	HITS-CLIP	23824327
MIRT635349	hsa-miR-6838-3p	HITS-CLIP	23824327
MIRT635348	hsa-miR-186-3p	HITS-CLIP	23824327
MIRT635347	hsa-miR-939-3p	HITS-CLIP	23824327
MIRT635346	hsa-miR-6852-5p	HITS-CLIP	23824327
MIRT635345	hsa-miR-6742-3p	HITS-CLIP	23824327
MIRT635344	hsa-miR-212-5p	HITS-CLIP	23824327
MIRT635343	hsa-miR-619-5p	HITS-CLIP	23824327
MIRT635342	hsa-miR-6506-5p	HITS-CLIP	23824327
MIRT635341	hsa-miR-4707-3p	HITS-CLIP	23824327
MIRT635340	hsa-miR-6778-3p	HITS-CLIP	23824327
MIRT635339	hsa-miR-4757-5p	HITS-CLIP	23824327
MIRT635338	hsa-miR-6744-3p	HITS-CLIP	23824327
MIRT635337	hsa-miR-1343-3p	HITS-CLIP	23824327
MIRT635336	hsa-miR-6783-3p	HITS-CLIP	23824327
MIRT635335	hsa-miR-6878-3p	HITS-CLIP	23824327
MIRT635334	hsa-miR-5089-5p	HITS-CLIP	23824327
MIRT572723	hsa-miR-193a-3p	PAR-CLIP	20371350
MIRT572722	hsa-miR-193b-3p	PAR-CLIP	20371350
MIRT572721	hsa-miR-892b	PAR-CLIP	20371350
MIRT572720	hsa-miR-646	PAR-CLIP	20371350
MIRT572719	hsa-miR-22-3p	PAR-CLIP	20371350
MIRT572718	hsa-miR-6882-3p	PAR-CLIP	20371350
MIRT572717	hsa-miR-6815-3p	PAR-CLIP	20371350
MIRT496142	hsa-miR-1910-3p	PAR-CLIP	22291592
MIRT496141	hsa-miR-6511a-5p	PAR-CLIP	22291592
MIRT496140	hsa-miR-6808-5p	PAR-CLIP	22291592
MIRT496139	hsa-miR-6893-5p	PAR-CLIP	22291592
MIRT496138	hsa-miR-940	PAR-CLIP	22291592
MIRT496137	hsa-miR-2682-5p	PAR-CLIP	22291592
MIRT496136	hsa-miR-34b-5p	PAR-CLIP	22291592
MIRT496135	hsa-miR-449c-5p	PAR-CLIP	22291592
MIRT496134	hsa-miR-4717-5p	PAR-CLIP	22291592
MIRT496133	hsa-miR-4690-3p	PAR-CLIP	22291592
MIRT496132	hsa-miR-5685	PAR-CLIP	22291592
MIRT496131	hsa-miR-6806-5p	PAR-CLIP	22291592
MIRT445711	hsa-miR-3662	PAR-CLIP	22100165
MIRT445710	hsa-miR-3646	PAR-CLIP	22100165
MIRT445709	hsa-miR-526b-5p	PAR-CLIP	22100165
MIRT445708	hsa-miR-580-3p	PAR-CLIP	22100165
MIRT445711	hsa-miR-3662	PAR-CLIP	22100165
MIRT445710	hsa-miR-3646	PAR-CLIP	22100165
MIRT445709	hsa-miR-526b-5p	PAR-CLIP	22100165
MIRT445708	hsa-miR-580-3p	PAR-CLIP	22100165
MIRT1294342	hsa-miR-106a	CLIP-seq
MIRT1294343	hsa-miR-106b	CLIP-seq
MIRT1294344	hsa-miR-1255a	CLIP-seq
MIRT1294345	hsa-miR-1255b	CLIP-seq
MIRT1294346	hsa-miR-1273f	CLIP-seq
MIRT1294347	hsa-miR-1296	CLIP-seq
MIRT1294348	hsa-miR-135a	CLIP-seq
MIRT1294349	hsa-miR-135b	CLIP-seq
MIRT1294350	hsa-miR-136	CLIP-seq
MIRT1294351	hsa-miR-142-5p	CLIP-seq
MIRT1294352	hsa-miR-143	CLIP-seq
MIRT1294353	hsa-miR-150	CLIP-seq
MIRT1294354	hsa-miR-17	CLIP-seq
MIRT1294355	hsa-miR-185	CLIP-seq
MIRT1294356	hsa-miR-1913	CLIP-seq
MIRT1294357	hsa-miR-20a	CLIP-seq
MIRT1294358	hsa-miR-20b	CLIP-seq
MIRT1294359	hsa-miR-24	CLIP-seq
MIRT1294360	hsa-miR-2909	CLIP-seq
MIRT1294361	hsa-miR-302a	CLIP-seq
MIRT1294362	hsa-miR-302b	CLIP-seq
MIRT1294363	hsa-miR-302c	CLIP-seq
MIRT1294364	hsa-miR-302d	CLIP-seq
MIRT1294365	hsa-miR-302e	CLIP-seq
MIRT1294366	hsa-miR-3140-3p	CLIP-seq
MIRT1294367	hsa-miR-3149	CLIP-seq
MIRT1294368	hsa-miR-3155	CLIP-seq
MIRT1294369	hsa-miR-3155b	CLIP-seq
MIRT1294370	hsa-miR-3158-3p	CLIP-seq
MIRT1294371	hsa-miR-3170	CLIP-seq
MIRT1294372	hsa-miR-320a	CLIP-seq
MIRT1294373	hsa-miR-320b	CLIP-seq
MIRT1294374	hsa-miR-320c	CLIP-seq
MIRT1294375	hsa-miR-320d	CLIP-seq
MIRT1294376	hsa-miR-324-3p	CLIP-seq
MIRT1294377	hsa-miR-330-3p	CLIP-seq
MIRT1294378	hsa-miR-340	CLIP-seq
MIRT1294379	hsa-miR-3652	CLIP-seq
MIRT1294380	hsa-miR-3653	CLIP-seq
MIRT1294381	hsa-miR-3658	CLIP-seq
MIRT1294382	hsa-miR-3659	CLIP-seq
MIRT1294383	hsa-miR-3663-5p	CLIP-seq
MIRT1294384	hsa-miR-371-5p	CLIP-seq
MIRT1294385	hsa-miR-371b-5p	CLIP-seq
MIRT1294386	hsa-miR-372	CLIP-seq
MIRT1294387	hsa-miR-373	CLIP-seq
MIRT1294388	hsa-miR-376a	CLIP-seq
MIRT1294389	hsa-miR-376b	CLIP-seq
MIRT1294390	hsa-miR-3913-3p	CLIP-seq
MIRT1294391	hsa-miR-3929	CLIP-seq
MIRT1294392	hsa-miR-3940-5p	CLIP-seq
MIRT1294393	hsa-miR-3978	CLIP-seq
MIRT1294394	hsa-miR-411	CLIP-seq
MIRT1294395	hsa-miR-4280	CLIP-seq
MIRT1294396	hsa-miR-4283	CLIP-seq
MIRT1294397	hsa-miR-4306	CLIP-seq
MIRT1294398	hsa-miR-4419b	CLIP-seq
MIRT1294399	hsa-miR-4422	CLIP-seq
MIRT1294400	hsa-miR-4428	CLIP-seq
MIRT1294401	hsa-miR-4429	CLIP-seq
MIRT1294402	hsa-miR-4430	CLIP-seq
MIRT1294403	hsa-miR-4437	CLIP-seq
MIRT1294404	hsa-miR-4438	CLIP-seq
MIRT1294405	hsa-miR-4446-3p	CLIP-seq
MIRT1294406	hsa-miR-4478	CLIP-seq
MIRT1294407	hsa-miR-4489	CLIP-seq
MIRT1294408	hsa-miR-4492	CLIP-seq
MIRT1294409	hsa-miR-4498	CLIP-seq
MIRT1294410	hsa-miR-4504	CLIP-seq
MIRT1294411	hsa-miR-4507	CLIP-seq
MIRT1294412	hsa-miR-4644	CLIP-seq
MIRT1294413	hsa-miR-4658	CLIP-seq
MIRT1294414	hsa-miR-4708-5p	CLIP-seq
MIRT1294415	hsa-miR-4716-5p	CLIP-seq
MIRT1294416	hsa-miR-4729	CLIP-seq
MIRT1294417	hsa-miR-4735-5p	CLIP-seq
MIRT1294418	hsa-miR-4762-5p	CLIP-seq
MIRT1294419	hsa-miR-4766-5p	CLIP-seq
MIRT1294420	hsa-miR-4770	CLIP-seq
MIRT1294421	hsa-miR-4775	CLIP-seq
MIRT1294422	hsa-miR-4781-3p	CLIP-seq
MIRT1294423	hsa-miR-4787-3p	CLIP-seq
MIRT1294424	hsa-miR-484	CLIP-seq
MIRT1294425	hsa-miR-487a	CLIP-seq
MIRT1294426	hsa-miR-489	CLIP-seq
MIRT1294427	hsa-miR-5095	CLIP-seq
MIRT1294428	hsa-miR-515-5p	CLIP-seq
MIRT1294429	hsa-miR-519d	CLIP-seq
MIRT1294430	hsa-miR-520a-3p	CLIP-seq
MIRT1294431	hsa-miR-520b	CLIP-seq
MIRT1294432	hsa-miR-520c-3p	CLIP-seq
MIRT1294433	hsa-miR-520d-3p	CLIP-seq
MIRT1294434	hsa-miR-520e	CLIP-seq
MIRT1294435	hsa-miR-520f	CLIP-seq
MIRT1294436	hsa-miR-542-3p	CLIP-seq
MIRT1294437	hsa-miR-574-5p	CLIP-seq
MIRT1294438	hsa-miR-590-3p	CLIP-seq
MIRT1294439	hsa-miR-758	CLIP-seq
MIRT1294440	hsa-miR-762	CLIP-seq
MIRT1294441	hsa-miR-875-3p	CLIP-seq
MIRT1294442	hsa-miR-93	CLIP-seq
MIRT1294443	hsa-miR-941	CLIP-seq
MIRT1294346	hsa-miR-1273f	CLIP-seq
MIRT2087541	hsa-miR-1343	CLIP-seq
MIRT1294350	hsa-miR-136	CLIP-seq
MIRT1294356	hsa-miR-1913	CLIP-seq
MIRT1294367	hsa-miR-3149	CLIP-seq
MIRT1294371	hsa-miR-3170	CLIP-seq
MIRT1294376	hsa-miR-324-3p	CLIP-seq
MIRT1294383	hsa-miR-3663-5p	CLIP-seq
MIRT1294394	hsa-miR-411	CLIP-seq
MIRT1294404	hsa-miR-4438	CLIP-seq
MIRT1294415	hsa-miR-4716-5p	CLIP-seq
MIRT1294417	hsa-miR-4735-5p	CLIP-seq
MIRT1294421	hsa-miR-4775	CLIP-seq
MIRT1294422	hsa-miR-4781-3p	CLIP-seq
MIRT1294423	hsa-miR-4787-3p	CLIP-seq
MIRT2087542	hsa-miR-498	CLIP-seq
MIRT1294427	hsa-miR-5095	CLIP-seq
MIRT1294428	hsa-miR-515-5p	CLIP-seq
MIRT2087543	hsa-miR-516a-3p	CLIP-seq
MIRT1294438	hsa-miR-590-3p	CLIP-seq
MIRT1294443	hsa-miR-941	CLIP-seq
MIRT1294346	hsa-miR-1273f	CLIP-seq
MIRT1294350	hsa-miR-136	CLIP-seq
MIRT1294351	hsa-miR-142-5p	CLIP-seq
MIRT1294353	hsa-miR-150	CLIP-seq
MIRT1294355	hsa-miR-185	CLIP-seq
MIRT1294368	hsa-miR-3155	CLIP-seq
MIRT1294369	hsa-miR-3155b	CLIP-seq
MIRT1294371	hsa-miR-3170	CLIP-seq
MIRT1294372	hsa-miR-320a	CLIP-seq
MIRT1294373	hsa-miR-320b	CLIP-seq
MIRT1294374	hsa-miR-320c	CLIP-seq
MIRT1294375	hsa-miR-320d	CLIP-seq
MIRT1294378	hsa-miR-340	CLIP-seq
MIRT1294383	hsa-miR-3663-5p	CLIP-seq
MIRT1294385	hsa-miR-371b-5p	CLIP-seq
MIRT1294397	hsa-miR-4306	CLIP-seq
MIRT1294400	hsa-miR-4428	CLIP-seq
MIRT1294401	hsa-miR-4429	CLIP-seq
MIRT1294404	hsa-miR-4438	CLIP-seq
MIRT1294412	hsa-miR-4644	CLIP-seq
MIRT2312369	hsa-miR-4698	CLIP-seq
MIRT1294415	hsa-miR-4716-5p	CLIP-seq
MIRT2312370	hsa-miR-4727-5p	CLIP-seq
MIRT1294417	hsa-miR-4735-5p	CLIP-seq
MIRT1294421	hsa-miR-4775	CLIP-seq
MIRT1294422	hsa-miR-4781-3p	CLIP-seq
MIRT1294423	hsa-miR-4787-3p	CLIP-seq
MIRT1294424	hsa-miR-484	CLIP-seq
MIRT2087542	hsa-miR-498	CLIP-seq
MIRT2312371	hsa-miR-505	CLIP-seq
MIRT1294427	hsa-miR-5095	CLIP-seq
MIRT1294428	hsa-miR-515-5p	CLIP-seq
MIRT2312372	hsa-miR-562	CLIP-seq
MIRT1294438	hsa-miR-590-3p	CLIP-seq
MIRT2312373	hsa-miR-888	CLIP-seq
MIRT1294443	hsa-miR-941	CLIP-seq
MIRT1294404	hsa-miR-4438	CLIP-seq
MIRT1294417	hsa-miR-4735-5p	CLIP-seq
MIRT1294421	hsa-miR-4775	CLIP-seq
MIRT1294423	hsa-miR-4787-3p	CLIP-seq
MIRT1294427	hsa-miR-5095	CLIP-seq
MIRT1294438	hsa-miR-590-3p	CLIP-seq
MIRT1294443	hsa-miR-941	CLIP-seq
MIRT1294346	hsa-miR-1273f	CLIP-seq
MIRT1294367	hsa-miR-3149	CLIP-seq
MIRT1294371	hsa-miR-3170	CLIP-seq
MIRT1294394	hsa-miR-411	CLIP-seq
MIRT2457853	hsa-miR-4427	CLIP-seq
MIRT2457854	hsa-miR-4680-3p	CLIP-seq
MIRT2457855	hsa-miR-4714-5p	CLIP-seq
MIRT1294417	hsa-miR-4735-5p	CLIP-seq
MIRT1294421	hsa-miR-4775	CLIP-seq
MIRT1294423	hsa-miR-4787-3p	CLIP-seq
MIRT2457856	hsa-miR-4790-3p	CLIP-seq
MIRT2457857	hsa-miR-549	CLIP-seq
MIRT1294438	hsa-miR-590-3p	CLIP-seq
MIRT1294443	hsa-miR-941	CLIP-seq
MIRT1294346	hsa-miR-1273f	CLIP-seq
MIRT2087541	hsa-miR-1343	CLIP-seq
MIRT1294367	hsa-miR-3149	CLIP-seq
MIRT1294394	hsa-miR-411	CLIP-seq
MIRT1294417	hsa-miR-4735-5p	CLIP-seq
MIRT1294421	hsa-miR-4775	CLIP-seq
MIRT1294423	hsa-miR-4787-3p	CLIP-seq
MIRT2087542	hsa-miR-498	CLIP-seq
MIRT2087543	hsa-miR-516a-3p	CLIP-seq
MIRT1294438	hsa-miR-590-3p	CLIP-seq
MIRT1294443	hsa-miR-941	CLIP-seq
MIRT1294342	hsa-miR-106a	CLIP-seq
MIRT1294343	hsa-miR-106b	CLIP-seq
MIRT2087541	hsa-miR-1343	CLIP-seq
MIRT1294354	hsa-miR-17	CLIP-seq
MIRT1294357	hsa-miR-20a	CLIP-seq
MIRT1294358	hsa-miR-20b	CLIP-seq
MIRT1294361	hsa-miR-302a	CLIP-seq
MIRT1294362	hsa-miR-302b	CLIP-seq
MIRT1294363	hsa-miR-302c	CLIP-seq
MIRT1294364	hsa-miR-302d	CLIP-seq
MIRT1294365	hsa-miR-302e	CLIP-seq
MIRT1294366	hsa-miR-3140-3p	CLIP-seq
MIRT1294367	hsa-miR-3149	CLIP-seq
MIRT1294386	hsa-miR-372	CLIP-seq
MIRT1294387	hsa-miR-373	CLIP-seq
MIRT1294388	hsa-miR-376a	CLIP-seq
MIRT1294389	hsa-miR-376b	CLIP-seq
MIRT1294394	hsa-miR-411	CLIP-seq
MIRT1294417	hsa-miR-4735-5p	CLIP-seq
MIRT1294419	hsa-miR-4766-5p	CLIP-seq
MIRT1294421	hsa-miR-4775	CLIP-seq
MIRT1294425	hsa-miR-487a	CLIP-seq
MIRT2087542	hsa-miR-498	CLIP-seq
MIRT2087543	hsa-miR-516a-3p	CLIP-seq
MIRT1294429	hsa-miR-519d	CLIP-seq
MIRT1294430	hsa-miR-520a-3p	CLIP-seq
MIRT1294431	hsa-miR-520b	CLIP-seq
MIRT1294432	hsa-miR-520c-3p	CLIP-seq
MIRT1294433	hsa-miR-520d-3p	CLIP-seq
MIRT1294434	hsa-miR-520e	CLIP-seq
MIRT1294435	hsa-miR-520f	CLIP-seq
MIRT1294438	hsa-miR-590-3p	CLIP-seq
MIRT1294442	hsa-miR-93	CLIP-seq
MIRT1294443	hsa-miR-941	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
ARID3A	Unknown	23659165
RB1	Repression	9671466

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000785	Component	Chromatin	IBA
GO:0000977	Function	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IBA
GO:0005515	Function	Protein binding	IPI	1331501, 9464541, 15467457, 16061792, 16189514, 16286473, 16360038, 16381817, 17620057, 21903422, 22094256, 22810586, 22898364, 23602568, 25609649, 32707033, 34661528
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA	8245034
GO:0005654	Component	Nucleoplasm	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005667	Component	Transcription regulator complex	IBA
GO:0005667	Component	Transcription regulator complex	IEA
GO:0006325	Process	Chromatin organization	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IEA
GO:0010468	Process	Regulation of gene expression	IEA
GO:0010558	Process	Negative regulation of macromolecule biosynthetic process	IEA
GO:0010629	Process	Negative regulation of gene expression	IMP	25100735
GO:0030154	Process	Cell differentiation	IBA
GO:0043550	Process	Regulation of lipid kinase activity	IDA	16286473
GO:0051726	Process	Regulation of cell cycle	IEA
GO:1990841	Function	Promoter-specific chromatin binding	IDA	25100735
GO:1990841	Function	Promoter-specific chromatin binding	IEA
GO:2000134	Process	Negative regulation of G1/S transition of mitotic cell cycle	IBA
GO:2000773	Process	Negative regulation of cellular senescence	IMP	28595801

Other IDs

• MIM: 116957
• HGNC: 9893
• e!Ensembl: ENSG00000080839

Protein

• UniProt ID: P28749
• Protein name: Retinoblastoma-like protein 1 (107 kDa retinoblastoma-associated protein) (p107) (pRb1)
• Protein function: Key regulator of entry into cell division (PubMed:17671431). Directly involved in heterochromatin formation by maintaining overall chromatin structure and, in particular, that of constitutive heterochromatin by stabilizing histone methylation (B
• PDB: 1H28, 4YOO, 4YOS, 4YOZ, 5TUV, 7SMC, 7SMD, 7SME, 7SMF
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF11934	DUF3452	77 → 212	Domain of unknown function (DUF3452)	Family
  PF01858	RB_A	385 → 578	Retinoblastoma-associated protein A domain	Domain
  PF01857	RB_B	787 → 943	Retinoblastoma-associated protein B domain	Domain

• Sequence:

  MFEDKPHAEGAAVVAAAGEALQALCQELNLDEGSAAEALDDFTAIRGNYSLEGEVTHWLA
  CSLYVACRKSIIPTVGKGIMEGNCVSLTRILRSAKLSLIQFFSKMKKWMDMSNLPQEFRE
  RIERLERNFEVSTVIFKKYEPIFLDIFQNPYEEPPKLPRSRKQRRIPCSVKDLFNFCWTL
  FVYTKGNFRMIGDDLVNSYHLLLCCLDLIFANAIMCPNRQDLLNPSFKGLPSDFHTADFT
  ASEEPPCIIAVLCELHDGLLVEAKGIKEHYFKPYISKLFDRKILKGECLLDLSSFTDNSK
  AVNKEYEEYVLTVGDFDERIFLGADAEEEIGTPRKFTRDTPLGKLTAQANVEYNLQQHFE
  KKRSFAPSTPLTGRRYLREKEAVITPVASATQSVSRLQSIVAGLKNAPSDQLINIFESCV
  RNPVENIMKILKGIGETFCQHYTQSTDEQPGSHIDFAVNRLKLAEILYYKILETVMVQET
  RRLHGMDMSVLLEQDIFHRSLMACCLEIVLFAYSSPRTFPWIIEVLNLQPFYFYKVIEVV
  IRSEEGLSRDMVKHLNSIEEQILESLAWSHDSALWEALQVSANKVPTCEEVIFPNNFETG
  NGGNVQGHLPLMPMSPLMHPRVKEVRTDSGSLRRDMQPLSPISVHERYSSPTAGSAKRRL
  FGEDPPKEMLMDKIITEGTKLKIAPSSSITAENVSILPGQTLLTMATAPVTGTTGHKVTI
  PLHGVANDAGEITLIPLSMNTNQESKVKSPVSLTAHSLIGASPKQTNLTKAQEVHSTGIN
  RPKRTGSLALFYRKVYHLASVRLRDLCLKLDVSNELRRKIWTCFEFTLVHCPDLMKDRHL
  DQLLLCAFYIMAKVTKEERTFQEIMKSYRNQPQANSHVYRSVLLKSIPREVVAYNKNIND
  DFEMIDCDLEDATKTPDCSSGPVKEERGDLIKFYNTIYVGRVKSFALKYDLANQDHMMDA
  PPLSPFPHIKQQPGSPRRISQQHSIYISPHKNGSGLTPRSALLYKFNGSPSKSLKDINNM
  IRQGEQRTKKRVIAIDSDAESPAKRVCQENDDVLLKRLQDVVSERANH

• Sequence length: 1068

Pathways

KEGG:

Cell cycle
Cellular senescence
TGF-beta signaling pathway
Human papillomavirus infection
Viral carcinogenesis

Reactome:

Transcription of E2F targets under negative control by DREAM complex
G0 and Early G1
SMAD2/SMAD3:SMAD4 heterotrimer regulates transcription
TP53 Regulates Transcription of Genes Involved in G2 Cell Cycle Arrest
Cyclin D associated events in G1

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
DIABETIC NEPHROPATHY	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute leukemia	Leukemia	BEFREE	31396671		★☆☆☆☆ Found in Text Mining only
Acute Megakaryocytic Leukemias	Megakaryocytic Leukemia	BEFREE	23963861		★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	LHGDN	14666683		★☆☆☆☆ Found in Text Mining only
Adult Diffuse Large B-Cell Lymphoma	B-cell Lymphoma	BEFREE	9790944		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	2729275	Associate	★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	BEFREE	30602619		★☆☆☆☆ Found in Text Mining only
Aortic Valve Disease	Aortic valve disease	Pubtator	37234568	Associate	★☆☆☆☆ Found in Text Mining only
Arrhythmogenic Right Ventricular Dysplasia	Arrhythmogenic right ventricular cardiomyopathy	BEFREE	29915098		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	35344278	Associate	★☆☆☆☆ Found in Text Mining only
Azoospermia	Azoospermia	Pubtator	38403804	Associate	★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	10863094		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	28218039		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	16537896, 26660119, 28218039, 9528753	Associate	★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt lymphoma	Pubtator	10702389	Associate	★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt lymphoma	Pubtator	8621409	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	34851822	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	15474160		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	9815552		★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	14671316		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	14671316		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	36828890	Associate	★☆☆☆☆ Found in Text Mining only
Chronic myeloproliferative disorder	Myeloproliferative disorder	BEFREE	21806350, 27544663, 28411309		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	29986714, 31191746	Associate	★☆☆☆☆ Found in Text Mining only
Deficiency of glucose-6-phosphate dehydrogenase	Deficiency Of Glucose-6-Phosphate Dehydrogenase	BEFREE	28152025		★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	9790944		★☆☆☆☆ Found in Text Mining only
Endometrial adenocarcinoma	Endometrial Adenocarcinoma	BEFREE	15474160		★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	16293976		★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	30383332		★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	22237625		★☆☆☆☆ Found in Text Mining only
Hemangioblastoma	Hemangioblastoma	BEFREE	31613797		★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	9790944		★☆☆☆☆ Found in Text Mining only
Hereditary Nonpolyposis Colorectal Cancer	Colorectal Cancer	BEFREE	8072530		★☆☆☆☆ Found in Text Mining only
Hypertrophic Cardiomyopathy	Hypertrophic cardiomyopathy	BEFREE	29915098		★☆☆☆☆ Found in Text Mining only
Hypertrophic obstructive cardiomyopathy	Hypertrophic cardiomyopathy	BEFREE	29915098		★☆☆☆☆ Found in Text Mining only
Iron Overload	Iron Overload	BEFREE	30602619		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	24736461	Associate	★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	30675257		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	7623799	Associate	★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	22237625		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	28218039		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	9815552		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	23853093, 24200968		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	10863094, 22237625, 22333593		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	14671316		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	16537896		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	Pubtator	11577176	Associate	★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	10727462	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	21635225		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	28830576, 31176293, 31385358		★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	30602619		★☆☆☆☆ Found in Text Mining only
Myelofibrosis	Myelofibrosis	BEFREE	24454890, 30405096, 31837568		★☆☆☆☆ Found in Text Mining only
Myeloproliferative disease	Myeloproliferative disorder	BEFREE	21095048		★☆☆☆☆ Found in Text Mining only
Myeloproliferative Neoplasm, Unclassifiable	Myeloproliferative Neoplasm	BEFREE	26071474		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10667590, 10667591, 11406530, 12769348, 14670612, 21635225, 23145321, 23715544, 24200968, 25576924, 26576645, 27966456, 29925966, 8446173, 8872613, 9136893, 9620848, 9776410, 9815552		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	22981769		★☆☆☆☆ Found in Text Mining only
NEUROTICISM	Neuroticism	BEFREE	11883728		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	31485853		★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	GWASCAT_DG	22142827, 28470677		★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	GWASDB_DG	22142827		★☆☆☆☆ Found in Text Mining only
Pancytopenia	Pancytopenia	BEFREE	24164830		★☆☆☆☆ Found in Text Mining only
Polycythemia Vera	Polycythemia Vera	BEFREE	19387466, 25397683		★☆☆☆☆ Found in Text Mining only
Primary Myelofibrosis	Myelofibrosis	BEFREE	21095048, 24454890, 25873496, 29115418, 30405096, 31837568		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	23853093, 24200968		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	18418057		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	20053773, 21630295, 25472581, 37352376	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	24200968	Inhibit	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	29330297		★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	10667590, 10863094, 11406530, 12612064, 12769348, 12870848, 1334491, 16061792, 16465443, 16936754, 22484813, 23686316, 23853093, 26576645, 27750399, 27966456, 28289097, 28928282, 28946006, 31613797, 8446173, 8872613, 9136893, 9556498, 9620848, 9776410		★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	Pubtator	17510060, 25252974, 8643454	Associate	★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	Pubtator	8413230	Inhibit	★☆☆☆☆ Found in Text Mining only
Seasonal Affective Disorder	Seasonal Affective Disorder	BEFREE	29218451		★☆☆☆☆ Found in Text Mining only
Sleep Apnea, Obstructive	Sleep Apnea	BEFREE	31485853		★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	31781628, 9192669	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	16158962		★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	30383332		★☆☆☆☆ Found in Text Mining only
Tendinitis	Tendinitis	BEFREE	30732820		★☆☆☆☆ Found in Text Mining only
Thrombocythemia, Essential	Thrombocythemia	BEFREE	25801912, 27579896, 27976991, 28509339, 29405428, 30405096, 30977935		★☆☆☆☆ Found in Text Mining only
Thrombocytosis	Thrombocytosis	BEFREE	30405096		★☆☆☆☆ Found in Text Mining only
Uterine Cervical Dysplasia	Uterine disease	Pubtator	16158962	Associate	★☆☆☆☆ Found in Text Mining only