RBBP7 (RB binding protein 7, chromatin remodeling factor)

Gene

• Entrez ID: 5931
• Gene name: RB binding protein 7, chromatin remodeling factor
• Gene symbol: RBBP7
• Synonyms (NCBI Gene): RbAp46, SPGFX9
• Chromosome: X
• Chromosome location: Xp22.2
• Summary: This protein is a ubiquitously expressed nuclear protein and belongs to a highly conserved subfamily of WD-repeat proteins. It is found among several proteins that binds directly to retinoblastoma protein, which regulates cell proliferation. The encoded p

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT016133	hsa-miR-421	Sequencing	20371350
MIRT028061	hsa-miR-93-5p	Sequencing	20371350
MIRT049160	hsa-miR-92a-3p	CLASH	23622248
MIRT046129	hsa-miR-30b-5p	CLASH	23622248
MIRT044126	hsa-miR-30e-3p	CLASH	23622248
MIRT546803	hsa-miR-4778-5p	PAR-CLIP	21572407
MIRT546802	hsa-miR-4742-3p	PAR-CLIP	21572407
MIRT546801	hsa-miR-3924	PAR-CLIP	21572407
MIRT546800	hsa-miR-3686	PAR-CLIP	21572407
MIRT439810	hsa-miR-106b-5p	HITS-CLIP	22473208
MIRT439809	hsa-miR-20a-5p	HITS-CLIP	22473208
MIRT439810	hsa-miR-106b-5p	HITS-CLIP	22473208
MIRT726781	hsa-miR-17-5p	HITS-CLIP	22473208
MIRT726780	hsa-miR-20b-5p	HITS-CLIP	22473208
MIRT028061	hsa-miR-93-5p	HITS-CLIP	22473208
MIRT726779	hsa-miR-519d-3p	HITS-CLIP	22473208
MIRT439809	hsa-miR-20a-5p	HITS-CLIP	22473208
MIRT546803	hsa-miR-4778-5p	PAR-CLIP	21572407
MIRT546802	hsa-miR-4742-3p	PAR-CLIP	21572407
MIRT546801	hsa-miR-3924	PAR-CLIP	21572407
MIRT546800	hsa-miR-3686	PAR-CLIP	21572407
MIRT1293929	hsa-miR-101	CLIP-seq
MIRT1293930	hsa-miR-106a	CLIP-seq
MIRT1293931	hsa-miR-106b	CLIP-seq
MIRT1293932	hsa-miR-1179	CLIP-seq
MIRT1293933	hsa-miR-1185	CLIP-seq
MIRT1293934	hsa-miR-1284	CLIP-seq
MIRT1293935	hsa-miR-144	CLIP-seq
MIRT1293936	hsa-miR-17	CLIP-seq
MIRT1293937	hsa-miR-186	CLIP-seq
MIRT1293938	hsa-miR-20a	CLIP-seq
MIRT1293939	hsa-miR-20b	CLIP-seq
MIRT1293940	hsa-miR-300	CLIP-seq
MIRT1293941	hsa-miR-302a	CLIP-seq
MIRT1293942	hsa-miR-302b	CLIP-seq
MIRT1293943	hsa-miR-302c	CLIP-seq
MIRT1293944	hsa-miR-302d	CLIP-seq
MIRT1293945	hsa-miR-302e	CLIP-seq
MIRT1293946	hsa-miR-3133	CLIP-seq
MIRT1293947	hsa-miR-3161	CLIP-seq
MIRT1293948	hsa-miR-338-5p	CLIP-seq
MIRT1293949	hsa-miR-3614-5p	CLIP-seq
MIRT1293950	hsa-miR-3679-5p	CLIP-seq
MIRT1293951	hsa-miR-3685	CLIP-seq
MIRT1293952	hsa-miR-372	CLIP-seq
MIRT1293953	hsa-miR-373	CLIP-seq
MIRT1293954	hsa-miR-381	CLIP-seq
MIRT1293955	hsa-miR-384	CLIP-seq
MIRT1293956	hsa-miR-4257	CLIP-seq
MIRT1293957	hsa-miR-4286	CLIP-seq
MIRT1293958	hsa-miR-4517	CLIP-seq
MIRT1293959	hsa-miR-4666-3p	CLIP-seq
MIRT1293960	hsa-miR-4786-3p	CLIP-seq
MIRT1293961	hsa-miR-488	CLIP-seq
MIRT1293962	hsa-miR-519d	CLIP-seq
MIRT1293963	hsa-miR-520a-3p	CLIP-seq
MIRT1293964	hsa-miR-520b	CLIP-seq
MIRT1293965	hsa-miR-520c-3p	CLIP-seq
MIRT1293966	hsa-miR-520d-3p	CLIP-seq
MIRT1293967	hsa-miR-520e	CLIP-seq
MIRT1293968	hsa-miR-532-5p	CLIP-seq
MIRT1293969	hsa-miR-93	CLIP-seq
MIRT1293929	hsa-miR-101	CLIP-seq
MIRT1293930	hsa-miR-106a	CLIP-seq
MIRT1293931	hsa-miR-106b	CLIP-seq
MIRT1293932	hsa-miR-1179	CLIP-seq
MIRT1293933	hsa-miR-1185	CLIP-seq
MIRT1293935	hsa-miR-144	CLIP-seq
MIRT1293936	hsa-miR-17	CLIP-seq
MIRT1293970	hsa-miR-181a	CLIP-seq
MIRT1293971	hsa-miR-181b	CLIP-seq
MIRT1293972	hsa-miR-181c	CLIP-seq
MIRT1293973	hsa-miR-181d	CLIP-seq
MIRT1293937	hsa-miR-186	CLIP-seq
MIRT1293938	hsa-miR-20a	CLIP-seq
MIRT1293939	hsa-miR-20b	CLIP-seq
MIRT1293941	hsa-miR-302a	CLIP-seq
MIRT1293942	hsa-miR-302b	CLIP-seq
MIRT1293943	hsa-miR-302c	CLIP-seq
MIRT1293944	hsa-miR-302d	CLIP-seq
MIRT1293945	hsa-miR-302e	CLIP-seq
MIRT1293946	hsa-miR-3133	CLIP-seq
MIRT1293949	hsa-miR-3614-5p	CLIP-seq
MIRT1293950	hsa-miR-3679-5p	CLIP-seq
MIRT1293952	hsa-miR-372	CLIP-seq
MIRT1293953	hsa-miR-373	CLIP-seq
MIRT1293956	hsa-miR-4257	CLIP-seq
MIRT1293974	hsa-miR-4262	CLIP-seq
MIRT1293975	hsa-miR-4272	CLIP-seq
MIRT1293957	hsa-miR-4286	CLIP-seq
MIRT1293976	hsa-miR-4709-5p	CLIP-seq
MIRT1293960	hsa-miR-4786-3p	CLIP-seq
MIRT1293961	hsa-miR-488	CLIP-seq
MIRT1293977	hsa-miR-494	CLIP-seq
MIRT1293962	hsa-miR-519d	CLIP-seq
MIRT1293963	hsa-miR-520a-3p	CLIP-seq
MIRT1293964	hsa-miR-520b	CLIP-seq
MIRT1293965	hsa-miR-520c-3p	CLIP-seq
MIRT1293966	hsa-miR-520d-3p	CLIP-seq
MIRT1293967	hsa-miR-520e	CLIP-seq
MIRT1293969	hsa-miR-93	CLIP-seq
MIRT2087377	hsa-miR-10a	CLIP-seq
MIRT2087378	hsa-miR-10b	CLIP-seq
MIRT1293932	hsa-miR-1179	CLIP-seq
MIRT2087379	hsa-miR-1236	CLIP-seq
MIRT2087380	hsa-miR-1292	CLIP-seq
MIRT2087381	hsa-miR-2116	CLIP-seq
MIRT2087382	hsa-miR-2276	CLIP-seq
MIRT2087383	hsa-miR-3120-3p	CLIP-seq
MIRT2087384	hsa-miR-3122	CLIP-seq
MIRT1293948	hsa-miR-338-5p	CLIP-seq
MIRT2087385	hsa-miR-3913-5p	CLIP-seq
MIRT2087386	hsa-miR-4471	CLIP-seq
MIRT2087387	hsa-miR-448	CLIP-seq
MIRT2087388	hsa-miR-4503	CLIP-seq
MIRT1293958	hsa-miR-4517	CLIP-seq
MIRT2087389	hsa-miR-4659a-3p	CLIP-seq
MIRT2087390	hsa-miR-4659b-3p	CLIP-seq
MIRT2087391	hsa-miR-4677-5p	CLIP-seq
MIRT2087392	hsa-miR-4753-3p	CLIP-seq
MIRT2087393	hsa-miR-4772-3p	CLIP-seq
MIRT2087394	hsa-miR-518a-5p	CLIP-seq
MIRT2087395	hsa-miR-527	CLIP-seq
MIRT2087396	hsa-miR-543	CLIP-seq
MIRT2087397	hsa-miR-544	CLIP-seq
MIRT2087398	hsa-miR-548an	CLIP-seq
MIRT2087399	hsa-miR-643	CLIP-seq
MIRT2087400	hsa-miR-942	CLIP-seq
MIRT1293929	hsa-miR-101	CLIP-seq
MIRT1293930	hsa-miR-106a	CLIP-seq
MIRT1293931	hsa-miR-106b	CLIP-seq
MIRT1293933	hsa-miR-1185	CLIP-seq
MIRT1293935	hsa-miR-144	CLIP-seq
MIRT1293936	hsa-miR-17	CLIP-seq
MIRT1293937	hsa-miR-186	CLIP-seq
MIRT1293938	hsa-miR-20a	CLIP-seq
MIRT1293939	hsa-miR-20b	CLIP-seq
MIRT1293941	hsa-miR-302a	CLIP-seq
MIRT1293942	hsa-miR-302b	CLIP-seq
MIRT1293943	hsa-miR-302c	CLIP-seq
MIRT1293944	hsa-miR-302d	CLIP-seq
MIRT1293945	hsa-miR-302e	CLIP-seq
MIRT1293946	hsa-miR-3133	CLIP-seq
MIRT1293949	hsa-miR-3614-5p	CLIP-seq
MIRT1293950	hsa-miR-3679-5p	CLIP-seq
MIRT1293952	hsa-miR-372	CLIP-seq
MIRT1293953	hsa-miR-373	CLIP-seq
MIRT1293956	hsa-miR-4257	CLIP-seq
MIRT1293961	hsa-miR-488	CLIP-seq
MIRT1293962	hsa-miR-519d	CLIP-seq
MIRT1293963	hsa-miR-520a-3p	CLIP-seq
MIRT1293964	hsa-miR-520b	CLIP-seq
MIRT1293965	hsa-miR-520c-3p	CLIP-seq
MIRT1293966	hsa-miR-520d-3p	CLIP-seq
MIRT1293967	hsa-miR-520e	CLIP-seq
MIRT1293969	hsa-miR-93	CLIP-seq
MIRT1293932	hsa-miR-1179	CLIP-seq
MIRT1293970	hsa-miR-181a	CLIP-seq
MIRT1293971	hsa-miR-181b	CLIP-seq
MIRT1293972	hsa-miR-181c	CLIP-seq
MIRT1293973	hsa-miR-181d	CLIP-seq
MIRT1293974	hsa-miR-4262	CLIP-seq
MIRT1293975	hsa-miR-4272	CLIP-seq
MIRT1293976	hsa-miR-4709-5p	CLIP-seq
MIRT1293929	hsa-miR-101	CLIP-seq
MIRT1293930	hsa-miR-106a	CLIP-seq
MIRT1293931	hsa-miR-106b	CLIP-seq
MIRT1293932	hsa-miR-1179	CLIP-seq
MIRT1293934	hsa-miR-1284	CLIP-seq
MIRT1293935	hsa-miR-144	CLIP-seq
MIRT1293936	hsa-miR-17	CLIP-seq
MIRT1293970	hsa-miR-181a	CLIP-seq
MIRT1293971	hsa-miR-181b	CLIP-seq
MIRT1293972	hsa-miR-181c	CLIP-seq
MIRT1293973	hsa-miR-181d	CLIP-seq
MIRT1293938	hsa-miR-20a	CLIP-seq
MIRT1293939	hsa-miR-20b	CLIP-seq
MIRT1293940	hsa-miR-300	CLIP-seq
MIRT1293941	hsa-miR-302a	CLIP-seq
MIRT1293942	hsa-miR-302b	CLIP-seq
MIRT1293943	hsa-miR-302c	CLIP-seq
MIRT1293944	hsa-miR-302d	CLIP-seq
MIRT1293945	hsa-miR-302e	CLIP-seq
MIRT1293947	hsa-miR-3161	CLIP-seq
MIRT1293949	hsa-miR-3614-5p	CLIP-seq
MIRT1293951	hsa-miR-3685	CLIP-seq
MIRT1293952	hsa-miR-372	CLIP-seq
MIRT1293953	hsa-miR-373	CLIP-seq
MIRT1293954	hsa-miR-381	CLIP-seq
MIRT1293955	hsa-miR-384	CLIP-seq
MIRT1293974	hsa-miR-4262	CLIP-seq
MIRT1293975	hsa-miR-4272	CLIP-seq
MIRT1293959	hsa-miR-4666-3p	CLIP-seq
MIRT1293976	hsa-miR-4709-5p	CLIP-seq
MIRT1293961	hsa-miR-488	CLIP-seq
MIRT1293962	hsa-miR-519d	CLIP-seq
MIRT1293963	hsa-miR-520a-3p	CLIP-seq
MIRT1293964	hsa-miR-520b	CLIP-seq
MIRT1293965	hsa-miR-520c-3p	CLIP-seq
MIRT1293966	hsa-miR-520d-3p	CLIP-seq
MIRT1293967	hsa-miR-520e	CLIP-seq
MIRT1293968	hsa-miR-532-5p	CLIP-seq
MIRT1293969	hsa-miR-93	CLIP-seq
MIRT1293929	hsa-miR-101	CLIP-seq
MIRT1293932	hsa-miR-1179	CLIP-seq
MIRT1293934	hsa-miR-1284	CLIP-seq
MIRT1293935	hsa-miR-144	CLIP-seq
MIRT1293970	hsa-miR-181a	CLIP-seq
MIRT1293971	hsa-miR-181b	CLIP-seq
MIRT1293972	hsa-miR-181c	CLIP-seq
MIRT1293973	hsa-miR-181d	CLIP-seq
MIRT1293940	hsa-miR-300	CLIP-seq
MIRT1293947	hsa-miR-3161	CLIP-seq
MIRT1293949	hsa-miR-3614-5p	CLIP-seq
MIRT1293951	hsa-miR-3685	CLIP-seq
MIRT1293954	hsa-miR-381	CLIP-seq
MIRT1293955	hsa-miR-384	CLIP-seq
MIRT1293974	hsa-miR-4262	CLIP-seq
MIRT1293975	hsa-miR-4272	CLIP-seq
MIRT1293959	hsa-miR-4666-3p	CLIP-seq
MIRT1293976	hsa-miR-4709-5p	CLIP-seq
MIRT1293961	hsa-miR-488	CLIP-seq
MIRT1293968	hsa-miR-532-5p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000118	Component	Histone deacetylase complex	IDA	9651585
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	NAS	9651585, 22865885
GO:0000781	Component	Chromosome, telomeric region	IDA	25150861
GO:0000781	Component	Chromosome, telomeric region	IEA
GO:0003723	Function	RNA binding	IEA
GO:0005515	Function	Protein binding	IPI	7503932, 9150135, 9651585, 18571423, 19497860, 19703393, 19862764, 21258344, 22720776, 23752268, 24981860, 25150861, 26496610, 27705803, 28179136, 28514442, 31980649, 33961781, 35271311
GO:0005634	Component	Nucleus	HDA	16791210
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	20523938, 22720776, 28977666, 33283408
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	NAS	14609955, 28554894
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005829	Component	Cytosol	IDA
GO:0006260	Process	DNA replication	IEA
GO:0006325	Process	Chromatin organization	IEA
GO:0006338	Process	Chromatin remodeling	IBA
GO:0006338	Process	Chromatin remodeling	IDA	9790534, 14609955
GO:0006355	Process	Regulation of DNA-templated transcription	IBA
GO:0006355	Process	Regulation of DNA-templated transcription	IDA	14609955
GO:0007420	Process	Brain development	NAS	14609955
GO:0016581	Component	NuRD complex	IBA
GO:0016581	Component	NuRD complex	IDA	19644445, 22926524, 33283408
GO:0016581	Component	NuRD complex	IEA
GO:0016581	Component	NuRD complex	NAS	16428440
GO:0016589	Component	NURF complex	IEA
GO:0016589	Component	NURF complex	IPI	14609955
GO:0030308	Process	Negative regulation of cell growth	IDA	9765217
GO:0030336	Process	Negative regulation of cell migration	NAS	22984288
GO:0030512	Process	Negative regulation of transforming growth factor beta receptor signaling pathway	NAS	22984288
GO:0035098	Component	ESC/E(Z) complex	IBA
GO:0035098	Component	ESC/E(Z) complex	IDA	20075857, 23104054, 23273982
GO:0035098	Component	ESC/E(Z) complex	IEA
GO:0042393	Function	Histone binding	IBA
GO:0042393	Function	Histone binding	IDA	9651585
GO:0042659	Process	Regulation of cell fate specification	NAS	22560079
GO:0045892	Process	Negative regulation of DNA-templated transcription	IEA
GO:0045892	Process	Negative regulation of DNA-templated transcription	NAS	22560079
GO:0045893	Process	Positive regulation of DNA-templated transcription	NAS	19927129
GO:0048545	Process	Response to steroid hormone	IEA
GO:0070370	Process	Cellular heat acclimation	IDA	7503932
GO:0070822	Component	Sin3-type complex	NAS	28554894
GO:1902455	Process	Negative regulation of stem cell population maintenance	NAS	28554894
GO:1902459	Process	Positive regulation of stem cell population maintenance	NAS	28554894
GO:1904949	Component	ATPase complex	IDA	14609955
GO:2000736	Process	Regulation of stem cell differentiation	NAS	22560079

Other IDs

• MIM: 300825
• HGNC: 9890
• e!Ensembl: ENSG00000102054

Protein

• UniProt ID: Q16576
• Protein name: Histone-binding protein RBBP7 (Histone acetyltransferase type B subunit 2) (Nucleosome-remodeling factor subunit RBAP46) (Retinoblastoma-binding protein 7) (RBBP-7) (Retinoblastoma-binding protein p46)
• Protein function: Core histone-binding subunit that may target chromatin remodeling factors, histone acetyltransferases and histone deacetylases to their histone substrates in a manner that is regulated by nucleosomal DNA. Component of several complexes which reg
• PDB: 3CFS, 3CFV, 7M3X
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF12265	CAF1C_H4-bd	18 → 87	Histone-binding protein RBBP4 or subunit C of CAF1 complex	Family
  PF00400	WD40	166 → 205	WD domain, G-beta repeat	Repeat
  PF00400	WD40	217 → 255	WD domain, G-beta repeat	Repeat
  PF00400	WD40	262 → 301	WD domain, G-beta repeat	Repeat
  PF00400	WD40	307 → 345	WD domain, G-beta repeat	Repeat
  PF00400	WD40	363 → 402	WD domain, G-beta repeat	Repeat

• Sequence:

  MASKEMFEDTVEERVINEEYKIWKKNTPFLYDLVMTHALQWPSLTVQWLPEVTKPEGKDY
  ALHWLVLGTHTSDEQNHLVVARVHIPNDDAQFDASHCDSDKGEFGGFGSVTGKIECEIKI
  NHEGEVNRARYMPQNPHIIATKTPSSDVLVFDYTKHPAKPDPSGECNPDLRLRGHQKEGY
  GLSWNSNLSGHLLSASDDHTVCLWDINAGPKEGKIVDAKAIFTGHSAVVEDVAWHLLHES
  LFGSVADDQKLMIWDTRSNTTSKPSHLVDAHTAEVNCLSFNPYSEFILATGSADKTVALW
  DLRNLKLKLHTFESHKDEIFQVHWSPHNETILASSGTDRRLNVWDLSKIGEEQSAEDAED
  GPPELLFIHGGHTAKISDFSWNPNEPWVICSVSEDNIMQIWQMAENIYNDEESDVTTSEL
  EGQGS

• Sequence length: 425

Pathways

KEGG:

ATP-dependent chromatin remodeling
Polycomb repressive complex

Reactome:

PRC2 methylates histones and DNA
Oxidative Stress Induced Senescence
HDACs deacetylate histones
PKMTs methylate histone lysines
HATs acetylate histones
RMTs methylate histone arginines
Deposition of new CENPA-containing nucleosomes at the centromere
Regulation of TP53 Activity through Acetylation
RNA Polymerase I Transcription Initiation
Regulation of PTEN gene transcription
Neddylation
Transcriptional Regulation by E2F6
HCMV Early Events

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
PROSTATE CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SPERMATOGENIC FAILURE, X-LINKED, 9	—	ClinVar, GenCC, HPO ClinVar, GenCC, HPO	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Atherosclerosis	Atherosclerosis	Pubtator	36720950	Associate	★☆☆☆☆ Found in Text Mining only
Azoospermia	Azoospermia	Pubtator	35809576	Associate	★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	20920292		★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	20920292	Associate	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	12767060, 14666671, 17314274, 17970062		★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	30637779	Associate	★☆☆☆☆ Found in Text Mining only
Cataract, congenital, with microcornea or slight microphthalmia	Congenital Cataract With Microcornea Or Slight Microphthalmia	BEFREE	15370543		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	31957828, 35538026	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	34086947	Associate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	35538026	Stimulate	★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	30637779		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	12767060, 14666671, 17314274, 17970062		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	30546458		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	14666671		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	14666671, 17314274, 18577416		★☆☆☆☆ Found in Text Mining only
Mental Retardation, X-Linked	Mental retardation	BEFREE	12376095		★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	Pubtator	26254420	Stimulate	★☆☆☆☆ Found in Text Mining only
Mesothelioma Malignant	Mesothelioma	Pubtator	26254420	Associate	★☆☆☆☆ Found in Text Mining only
Nance-Horan syndrome	Nance-Horan Syndrome	BEFREE	15370543		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	11433396, 12767060, 14981905, 17314274, 30546458		★☆☆☆☆ Found in Text Mining only
Nephroblastoma	Nephroblastoma	BEFREE	11433396, 12767060, 9765217		★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	11394910, 11433396, 12767060, 14666671, 14981905, 17970062, 18577416, 9765217		★☆☆☆☆ Found in Text Mining only
Rhabdomyoma	Rhabdomyoma	BEFREE	30120321		★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	BEFREE	30120321		★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	Pubtator	30120321	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	Pubtator	26254420	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	30546458		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	29263092	Associate	★☆☆☆☆ Found in Text Mining only