Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Associated diseases
Entrez ID	5918
Gene name	Retinoic acid receptor responder 1
Gene symbol	RARRES1
Synonyms (NCBI Gene)	LXNLPERG-1TIG1
Chromosome	3
Chromosome location	3q25.32
Summary	This gene was identified as a retinoid acid (RA) receptor-responsive gene. It encodes a type 1 membrane protein. The expression of this gene is upregulated by tazarotene as well as by retinoic acid receptors. The expression of this gene is found to be dow

Show/Hide all (94)

miRTarBase ID	miRNA	Experiments
MIRT1291725	hsa-miR-186	CLIP-seq
MIRT1291726	hsa-miR-567	CLIP-seq
MIRT2608088	hsa-miR-125a-5p	CLIP-seq
MIRT2608089	hsa-miR-125b	CLIP-seq
MIRT2608090	hsa-miR-1284	CLIP-seq
MIRT2608091	hsa-miR-134	CLIP-seq
MIRT2608092	hsa-miR-138	CLIP-seq
MIRT2608093	hsa-miR-2054	CLIP-seq
MIRT2608094	hsa-miR-2115	CLIP-seq
MIRT2608095	hsa-miR-28-3p	CLIP-seq
MIRT2608096	hsa-miR-3118	CLIP-seq
MIRT2608097	hsa-miR-3144-3p	CLIP-seq
MIRT2608098	hsa-miR-3146	CLIP-seq
MIRT2608099	hsa-miR-3180-5p	CLIP-seq
MIRT2608100	hsa-miR-33a	CLIP-seq
MIRT2608101	hsa-miR-33b	CLIP-seq
MIRT2608102	hsa-miR-3613-3p	CLIP-seq
MIRT2608103	hsa-miR-370	CLIP-seq
MIRT2608104	hsa-miR-3914	CLIP-seq
MIRT2608105	hsa-miR-3915	CLIP-seq
MIRT2608106	hsa-miR-3928	CLIP-seq
MIRT2608107	hsa-miR-4276	CLIP-seq
MIRT2608108	hsa-miR-4299	CLIP-seq
MIRT2608109	hsa-miR-4302	CLIP-seq
MIRT2608110	hsa-miR-4303	CLIP-seq
MIRT2608111	hsa-miR-4319	CLIP-seq
MIRT2608112	hsa-miR-4446-5p	CLIP-seq
MIRT2608113	hsa-miR-4464	CLIP-seq
MIRT2608114	hsa-miR-4468	CLIP-seq
MIRT2608115	hsa-miR-452	CLIP-seq
MIRT2608116	hsa-miR-4676-3p	CLIP-seq
MIRT2608117	hsa-miR-4682	CLIP-seq
MIRT2608118	hsa-miR-4748	CLIP-seq
MIRT2608119	hsa-miR-4762-3p	CLIP-seq
MIRT2608120	hsa-miR-4796-5p	CLIP-seq
MIRT2608121	hsa-miR-491-3p	CLIP-seq
MIRT2608122	hsa-miR-520a-5p	CLIP-seq
MIRT2608123	hsa-miR-525-5p	CLIP-seq
MIRT2608124	hsa-miR-539	CLIP-seq
MIRT2608125	hsa-miR-544b	CLIP-seq
MIRT2608126	hsa-miR-548aa	CLIP-seq
MIRT2608127	hsa-miR-548ac	CLIP-seq
MIRT2608128	hsa-miR-548d-3p	CLIP-seq
MIRT2608129	hsa-miR-548z	CLIP-seq
MIRT2608130	hsa-miR-648	CLIP-seq
MIRT2608131	hsa-miR-875-5p	CLIP-seq
MIRT2608132	hsa-miR-943	CLIP-seq
MIRT2608133	hsa-miR-944	CLIP-seq
MIRT2608088	hsa-miR-125a-5p	CLIP-seq
MIRT2608089	hsa-miR-125b	CLIP-seq
MIRT2608090	hsa-miR-1284	CLIP-seq
MIRT2608091	hsa-miR-134	CLIP-seq
MIRT2608092	hsa-miR-138	CLIP-seq
MIRT2608093	hsa-miR-2054	CLIP-seq
MIRT2608094	hsa-miR-2115	CLIP-seq
MIRT2608095	hsa-miR-28-3p	CLIP-seq
MIRT2608096	hsa-miR-3118	CLIP-seq
MIRT2608097	hsa-miR-3144-3p	CLIP-seq
MIRT2608098	hsa-miR-3146	CLIP-seq
MIRT2608099	hsa-miR-3180-5p	CLIP-seq
MIRT2608100	hsa-miR-33a	CLIP-seq
MIRT2608101	hsa-miR-33b	CLIP-seq
MIRT2608102	hsa-miR-3613-3p	CLIP-seq
MIRT2608103	hsa-miR-370	CLIP-seq
MIRT2608104	hsa-miR-3914	CLIP-seq
MIRT2608105	hsa-miR-3915	CLIP-seq
MIRT2608106	hsa-miR-3928	CLIP-seq
MIRT2608107	hsa-miR-4276	CLIP-seq
MIRT2608108	hsa-miR-4299	CLIP-seq
MIRT2608109	hsa-miR-4302	CLIP-seq
MIRT2608110	hsa-miR-4303	CLIP-seq
MIRT2608111	hsa-miR-4319	CLIP-seq
MIRT2608112	hsa-miR-4446-5p	CLIP-seq
MIRT2608113	hsa-miR-4464	CLIP-seq
MIRT2608114	hsa-miR-4468	CLIP-seq
MIRT2608115	hsa-miR-452	CLIP-seq
MIRT2608116	hsa-miR-4676-3p	CLIP-seq
MIRT2608117	hsa-miR-4682	CLIP-seq
MIRT2608118	hsa-miR-4748	CLIP-seq
MIRT2608119	hsa-miR-4762-3p	CLIP-seq
MIRT2608120	hsa-miR-4796-5p	CLIP-seq
MIRT2608121	hsa-miR-491-3p	CLIP-seq
MIRT2608122	hsa-miR-520a-5p	CLIP-seq
MIRT2608123	hsa-miR-525-5p	CLIP-seq
MIRT2608124	hsa-miR-539	CLIP-seq
MIRT2608125	hsa-miR-544b	CLIP-seq
MIRT2608126	hsa-miR-548aa	CLIP-seq
MIRT2608127	hsa-miR-548ac	CLIP-seq
MIRT2608128	hsa-miR-548d-3p	CLIP-seq
MIRT2608129	hsa-miR-548z	CLIP-seq
MIRT2608130	hsa-miR-648	CLIP-seq
MIRT2608131	hsa-miR-875-5p	CLIP-seq
MIRT2608132	hsa-miR-943	CLIP-seq
MIRT2608133	hsa-miR-944	CLIP-seq

Show/Hide all (1)

Transcription factor	Regulation	Reference
CTCF	Activation	22615834

Show/Hide all (10)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	21303978, 31886233
GO:0005576	Component	Extracellular region	IEA
GO:0005615	Component	Extracellular space	IBA
GO:0008191	Function	Metalloendopeptidase inhibitor activity	IBA
GO:0008285	Process	Negative regulation of cell population proliferation	IEA
GO:0008285	Process	Negative regulation of cell population proliferation	TAS	9270552
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	TAS	8601727
GO:0030414	Function	Peptidase inhibitor activity	IEA
GO:0070062	Component	Extracellular exosome	HDA	19199708

MIM	HGNC	e!Ensembl
605090	9867	ENSG00000118849

P49788

Protein name

Retinoic acid receptor responder protein 1 (Phorbol ester-induced gene 1 protein) (PERG-1) (RAR-responsive protein TIG1) (Tazarotene-induced gene 1 protein)

Protein function

Inhibitor of the cytoplasmic carboxypeptidase AGBL2, may regulate the alpha-tubulin tyrosination cycle.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF06907	Latexin	52 → 274	Latexin	Family

Tissue specificity

TISSUE SPECIFICITY: Detected in urine (at protein level). {ECO:0000269|PubMed:36213313, ECO:0000269|PubMed:37453717}.

Sequence

MQPRRQRLPAPWSGPRGPRPTAPLLALLLLLAPVAAPAGSGDPDDPGQPQDAGVPRRLLQ
QAARAALHFFNFRSGSPSALRVLAEVQEGRAWINPKEGCKVHVVFSTERYNPESLLQEGE
GRLGKCSARVFFKNQKPRPTINVTCTRLIEKKKRQQEDYLLYKQMKQLKNPLEIVSIPDN
HGHIDPSLRLIWDLAFLGSSYVMWEMTTQVSHYYLAQLTSVRQWKTNDDTIDFDYTVLLH
ELSTQEIIPCRIHLVWYPGKPLKVKYHCQELQTPEEASGTEEGSAVVPTELSNF

Sequence length

294

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (3)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ASTHMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STOMACH NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (62)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenomatous Polyposis Coli	Multiple polyposis syndrome	BEFREE	15328191		★★★★★ ★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	18004747, 18242387, 21694441		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	18006010		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	22615834, 27286452		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	22615834	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	21303978	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	11929948, 19806788		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal	Ductal carcinoma	Pubtator	34717732	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	24006221	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Intraductal Noninfiltrating	Intraductal noninfiltrating carcinoma	Pubtator	34717732	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	18006010		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	32307444, 36353618	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	17550320	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Choriocarcinoma	Choriocarcinoma	BEFREE	29169400		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	21575264		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	27989102	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	22126303	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	27339486		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	15886297		★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	15886297	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	18288381		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	16128742	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Extrahepatic Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	17550320		★★★★★ ★☆☆☆☆ Found in Text Mining only
Familial lichen amyloidosis	Lichen amyloidosis	BEFREE	18004747, 24324057		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	30557378		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty liver	Pubtator	30557378	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	31632537		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	31632537		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Diffuse Gastric Cancer	Gastric Cancer	CTD_human_DG	16134180		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Hyperinsulinism	BEFREE	30557378		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperinsulinism	Hyperinsulinism	Pubtator	30557378	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Breast Carcinoma	Breast Cancer	BEFREE	24014597		★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	15059893		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	24006221		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	27286452		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	14691453, 15059893, 15328191, 18242387, 21694441, 22573467, 24324057, 28678839		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	CTD_human_DG	16134180		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	19806788, 20021617		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	18006010		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	15059893, 19806788, 27286452, 28678839, 30899431, 31632537		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	21575264		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	21606880	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	15455391, 19737656		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	11929948, 15059893, 15455391, 15886297, 16134180, 19806788, 21575264, 22126303, 22573467, 22615834, 24006221, 27286452, 27989102, 28678839, 29169400, 29902837, 30557378, 30899431 View all (3 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	20546602	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	30557378	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Oral Submucous Fibrosis	Oral Submucous Fibrosis	BEFREE	21591998		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	39972314	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	14691453, 15059893, 15328191, 18242387, 21694441, 22573467, 24324057, 27989102, 28678839		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	21694441, 27708246, 30882175	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	28678839	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	8601727		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	27339486		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	LHGDN	16128742		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	16128742		★★★★★ ★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	30557378		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	19806788		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	CTD_human_DG	16134180		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stomach Neoplasms	Stomach neoplasms	Pubtator	16134180	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Testicular Neoplasms	Testicular neoplasm	Pubtator	31886233	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	27286452		★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	29902837	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

RARRES1 (retinoic acid receptor responder 1)