Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	5916
Gene name	Retinoic acid receptor gamma
Gene symbol	RARG
Synonyms (NCBI Gene)	NR1B3RARCRARgamma
Chromosome	12
Chromosome location	12q13.13
Summary	This gene encodes a retinoic acid receptor that belongs to the nuclear hormone receptor family. Retinoic acid receptors (RARs) act as ligand-dependent transcriptional regulators. When bound to ligands, RARs activate transcription by binding as heterodimer

261

Show/Hide all (261)

miRTarBase ID	miRNA	Experiments	Reference
MIRT001222	hsa-miR-182-5p	Luciferase reporter assayWestern blot	19782699
MIRT001222	hsa-miR-182-5p	Luciferase reporter assayWestern blot	19782699
MIRT002564	hsa-miR-124-3p	Microarray	15685193
MIRT017251	hsa-miR-335-5p	Microarray	18185580
MIRT002564	hsa-miR-124-3p	Microarray;Other	15685193
MIRT036166	hsa-miR-320c	CLASH	23622248
MIRT054345	hsa-miR-34c-5p	Luciferase reporter assayqRT-PCR	23097316
MIRT439118	hsa-miR-10b-5p	3'LIFE	25074381
MIRT439118	hsa-miR-10b-5p	3'LIFE	25074381
MIRT1291654	hsa-miR-2467-3p	CLIP-seq
MIRT1291655	hsa-miR-3125	CLIP-seq
MIRT1291656	hsa-miR-3179	CLIP-seq
MIRT1291657	hsa-miR-3190	CLIP-seq
MIRT1291658	hsa-miR-3202	CLIP-seq
MIRT1291659	hsa-miR-3916	CLIP-seq
MIRT1291660	hsa-miR-3919	CLIP-seq
MIRT1291661	hsa-miR-4330	CLIP-seq
MIRT1291662	hsa-miR-4476	CLIP-seq
MIRT1291663	hsa-miR-4675	CLIP-seq
MIRT1291664	hsa-miR-4741	CLIP-seq
MIRT1291665	hsa-miR-4756-3p	CLIP-seq
MIRT1291666	hsa-miR-1271	CLIP-seq
MIRT1291667	hsa-miR-1273f	CLIP-seq
MIRT1291668	hsa-miR-143	CLIP-seq
MIRT1291669	hsa-miR-182	CLIP-seq
MIRT1291670	hsa-miR-191	CLIP-seq
MIRT1291671	hsa-miR-1913	CLIP-seq
MIRT1291672	hsa-miR-298	CLIP-seq
MIRT1291673	hsa-miR-3065-3p	CLIP-seq
MIRT1291674	hsa-miR-30a	CLIP-seq
MIRT1291675	hsa-miR-30b	CLIP-seq
MIRT1291676	hsa-miR-30c	CLIP-seq
MIRT1291677	hsa-miR-30d	CLIP-seq
MIRT1291678	hsa-miR-30e	CLIP-seq
MIRT1291679	hsa-miR-3121-3p	CLIP-seq
MIRT1291680	hsa-miR-3130-3p	CLIP-seq
MIRT1291681	hsa-miR-3132	CLIP-seq
MIRT1291682	hsa-miR-3175	CLIP-seq
MIRT1291656	hsa-miR-3179	CLIP-seq
MIRT1291683	hsa-miR-3189-5p	CLIP-seq
MIRT1291658	hsa-miR-3202	CLIP-seq
MIRT1291684	hsa-miR-324-3p	CLIP-seq
MIRT1291685	hsa-miR-3616-3p	CLIP-seq
MIRT1291686	hsa-miR-3620	CLIP-seq
MIRT1291687	hsa-miR-3925-5p	CLIP-seq
MIRT1291688	hsa-miR-3942-5p	CLIP-seq
MIRT1291689	hsa-miR-4266	CLIP-seq
MIRT1291690	hsa-miR-4270	CLIP-seq
MIRT1291691	hsa-miR-4436b-3p	CLIP-seq
MIRT1291692	hsa-miR-4441	CLIP-seq
MIRT1291693	hsa-miR-4443	CLIP-seq
MIRT1291694	hsa-miR-4450	CLIP-seq
MIRT1291695	hsa-miR-4451	CLIP-seq
MIRT1291696	hsa-miR-4495	CLIP-seq
MIRT1291697	hsa-miR-450b-5p	CLIP-seq
MIRT1291698	hsa-miR-4534	CLIP-seq
MIRT1291699	hsa-miR-4535	CLIP-seq
MIRT1291700	hsa-miR-4667-5p	CLIP-seq
MIRT1291701	hsa-miR-4680-5p	CLIP-seq
MIRT1291702	hsa-miR-4695-5p	CLIP-seq
MIRT1291703	hsa-miR-4700-5p	CLIP-seq
MIRT1291704	hsa-miR-4703-5p	CLIP-seq
MIRT1291705	hsa-miR-4708-5p	CLIP-seq
MIRT1291706	hsa-miR-4728-5p	CLIP-seq
MIRT1291707	hsa-miR-4732-3p	CLIP-seq
MIRT1291708	hsa-miR-4758-3p	CLIP-seq
MIRT1291709	hsa-miR-4770	CLIP-seq
MIRT1291710	hsa-miR-4779	CLIP-seq
MIRT1291711	hsa-miR-4781-5p	CLIP-seq
MIRT1291712	hsa-miR-4793-3p	CLIP-seq
MIRT1291713	hsa-miR-4802-5p	CLIP-seq
MIRT1291714	hsa-miR-492	CLIP-seq
MIRT1291715	hsa-miR-507	CLIP-seq
MIRT1291716	hsa-miR-512-5p	CLIP-seq
MIRT1291717	hsa-miR-518a-5p	CLIP-seq
MIRT1291718	hsa-miR-527	CLIP-seq
MIRT1291719	hsa-miR-545	CLIP-seq
MIRT1291720	hsa-miR-557	CLIP-seq
MIRT1291721	hsa-miR-615-3p	CLIP-seq
MIRT1291722	hsa-miR-765	CLIP-seq
MIRT1291723	hsa-miR-885-3p	CLIP-seq
MIRT1291724	hsa-miR-96	CLIP-seq
MIRT2086758	hsa-miR-103a	CLIP-seq
MIRT2086759	hsa-miR-107	CLIP-seq
MIRT2086760	hsa-miR-124	CLIP-seq
MIRT1291666	hsa-miR-1271	CLIP-seq
MIRT1291667	hsa-miR-1273f	CLIP-seq
MIRT2086761	hsa-miR-1321	CLIP-seq
MIRT2086762	hsa-miR-15a	CLIP-seq
MIRT2086763	hsa-miR-15b	CLIP-seq
MIRT2086764	hsa-miR-16	CLIP-seq
MIRT1291669	hsa-miR-182	CLIP-seq
MIRT2086765	hsa-miR-195	CLIP-seq
MIRT2086766	hsa-miR-28-5p	CLIP-seq
MIRT1291673	hsa-miR-3065-3p	CLIP-seq
MIRT1291674	hsa-miR-30a	CLIP-seq
MIRT1291675	hsa-miR-30b	CLIP-seq
MIRT1291676	hsa-miR-30c	CLIP-seq
MIRT1291677	hsa-miR-30d	CLIP-seq
MIRT1291678	hsa-miR-30e	CLIP-seq
MIRT1291679	hsa-miR-3121-3p	CLIP-seq
MIRT2086767	hsa-miR-3121-5p	CLIP-seq
MIRT2086768	hsa-miR-3127-5p	CLIP-seq
MIRT1291680	hsa-miR-3130-3p	CLIP-seq
MIRT1291681	hsa-miR-3132	CLIP-seq
MIRT2086769	hsa-miR-3139	CLIP-seq
MIRT2086770	hsa-miR-3141	CLIP-seq
MIRT2086771	hsa-miR-3150a-3p	CLIP-seq
MIRT2086772	hsa-miR-3162-5p	CLIP-seq
MIRT1291682	hsa-miR-3175	CLIP-seq
MIRT1291656	hsa-miR-3179	CLIP-seq
MIRT1291657	hsa-miR-3190	CLIP-seq
MIRT2086773	hsa-miR-3192	CLIP-seq
MIRT2086774	hsa-miR-3194-3p	CLIP-seq
MIRT1291658	hsa-miR-3202	CLIP-seq
MIRT2086775	hsa-miR-324-5p	CLIP-seq
MIRT2086776	hsa-miR-326	CLIP-seq
MIRT2086777	hsa-miR-330-5p	CLIP-seq
MIRT2086778	hsa-miR-331-3p	CLIP-seq
MIRT1291685	hsa-miR-3616-3p	CLIP-seq
MIRT1291686	hsa-miR-3620	CLIP-seq
MIRT2086779	hsa-miR-3918	CLIP-seq
MIRT1291660	hsa-miR-3919	CLIP-seq
MIRT1291687	hsa-miR-3925-5p	CLIP-seq
MIRT2086780	hsa-miR-3936	CLIP-seq
MIRT1291688	hsa-miR-3942-5p	CLIP-seq
MIRT2086781	hsa-miR-424	CLIP-seq
MIRT2086782	hsa-miR-4254	CLIP-seq
MIRT1291690	hsa-miR-4270	CLIP-seq
MIRT2086783	hsa-miR-4292	CLIP-seq
MIRT2086784	hsa-miR-4308	CLIP-seq
MIRT2086785	hsa-miR-4314	CLIP-seq
MIRT2086786	hsa-miR-4323	CLIP-seq
MIRT2086787	hsa-miR-4326	CLIP-seq
MIRT1291691	hsa-miR-4436b-3p	CLIP-seq
MIRT2086788	hsa-miR-4437	CLIP-seq
MIRT1291692	hsa-miR-4441	CLIP-seq
MIRT1291695	hsa-miR-4451	CLIP-seq
MIRT1291662	hsa-miR-4476	CLIP-seq
MIRT1291696	hsa-miR-4495	CLIP-seq
MIRT2086789	hsa-miR-451b	CLIP-seq
MIRT2086790	hsa-miR-4533	CLIP-seq
MIRT2086791	hsa-miR-4640-5p	CLIP-seq
MIRT2086792	hsa-miR-4646-5p	CLIP-seq
MIRT1291700	hsa-miR-4667-5p	CLIP-seq
MIRT2086793	hsa-miR-4674	CLIP-seq
MIRT1291703	hsa-miR-4700-5p	CLIP-seq
MIRT1291704	hsa-miR-4703-5p	CLIP-seq
MIRT2086794	hsa-miR-4704-3p	CLIP-seq
MIRT2086795	hsa-miR-4726-5p	CLIP-seq
MIRT1291706	hsa-miR-4728-5p	CLIP-seq
MIRT2086796	hsa-miR-4739	CLIP-seq
MIRT1291665	hsa-miR-4756-3p	CLIP-seq
MIRT2086797	hsa-miR-4756-5p	CLIP-seq
MIRT1291710	hsa-miR-4779	CLIP-seq
MIRT1291711	hsa-miR-4781-5p	CLIP-seq
MIRT2086798	hsa-miR-4786-3p	CLIP-seq
MIRT1291712	hsa-miR-4793-3p	CLIP-seq
MIRT2086799	hsa-miR-497	CLIP-seq
MIRT2086800	hsa-miR-506	CLIP-seq
MIRT1291716	hsa-miR-512-5p	CLIP-seq
MIRT2086801	hsa-miR-541	CLIP-seq
MIRT1291719	hsa-miR-545	CLIP-seq
MIRT2086802	hsa-miR-622	CLIP-seq
MIRT2086803	hsa-miR-637	CLIP-seq
MIRT2086804	hsa-miR-654-5p	CLIP-seq
MIRT2086805	hsa-miR-708	CLIP-seq
MIRT1291722	hsa-miR-765	CLIP-seq
MIRT1291723	hsa-miR-885-3p	CLIP-seq
MIRT2086806	hsa-miR-939	CLIP-seq
MIRT1291724	hsa-miR-96	CLIP-seq
MIRT1291686	hsa-miR-3620	CLIP-seq
MIRT2086766	hsa-miR-28-5p	CLIP-seq
MIRT2086769	hsa-miR-3139	CLIP-seq
MIRT1291656	hsa-miR-3179	CLIP-seq
MIRT1291658	hsa-miR-3202	CLIP-seq
MIRT2086776	hsa-miR-326	CLIP-seq
MIRT2086777	hsa-miR-330-5p	CLIP-seq
MIRT1291662	hsa-miR-4476	CLIP-seq
MIRT1291706	hsa-miR-4728-5p	CLIP-seq
MIRT2086805	hsa-miR-708	CLIP-seq
MIRT1291667	hsa-miR-1273f	CLIP-seq
MIRT1291668	hsa-miR-143	CLIP-seq
MIRT2086766	hsa-miR-28-5p	CLIP-seq
MIRT1291672	hsa-miR-298	CLIP-seq
MIRT1291674	hsa-miR-30a	CLIP-seq
MIRT1291675	hsa-miR-30b	CLIP-seq
MIRT1291676	hsa-miR-30c	CLIP-seq
MIRT1291677	hsa-miR-30d	CLIP-seq
MIRT1291678	hsa-miR-30e	CLIP-seq
MIRT2086769	hsa-miR-3139	CLIP-seq
MIRT2311690	hsa-miR-34a	CLIP-seq
MIRT1291686	hsa-miR-3620	CLIP-seq
MIRT2311691	hsa-miR-3675-5p	CLIP-seq
MIRT1291687	hsa-miR-3925-5p	CLIP-seq
MIRT1291690	hsa-miR-4270	CLIP-seq
MIRT1291692	hsa-miR-4441	CLIP-seq
MIRT2311692	hsa-miR-449a	CLIP-seq
MIRT2311693	hsa-miR-449b	CLIP-seq
MIRT2086789	hsa-miR-451b	CLIP-seq
MIRT1291698	hsa-miR-4534	CLIP-seq
MIRT2311694	hsa-miR-4663	CLIP-seq
MIRT1291705	hsa-miR-4708-5p	CLIP-seq
MIRT1291706	hsa-miR-4728-5p	CLIP-seq
MIRT1291709	hsa-miR-4770	CLIP-seq
MIRT1291713	hsa-miR-4802-5p	CLIP-seq
MIRT2311695	hsa-miR-486-3p	CLIP-seq
MIRT2311696	hsa-miR-512-3p	CLIP-seq
MIRT2086801	hsa-miR-541	CLIP-seq
MIRT2086804	hsa-miR-654-5p	CLIP-seq
MIRT2086805	hsa-miR-708	CLIP-seq
MIRT1291722	hsa-miR-765	CLIP-seq
MIRT1291666	hsa-miR-1271	CLIP-seq
MIRT1291667	hsa-miR-1273f	CLIP-seq
MIRT1291669	hsa-miR-182	CLIP-seq
MIRT2432444	hsa-miR-1909	CLIP-seq
MIRT1291674	hsa-miR-30a	CLIP-seq
MIRT1291675	hsa-miR-30b	CLIP-seq
MIRT1291676	hsa-miR-30c	CLIP-seq
MIRT1291677	hsa-miR-30d	CLIP-seq
MIRT1291678	hsa-miR-30e	CLIP-seq
MIRT1291679	hsa-miR-3121-3p	CLIP-seq
MIRT1291681	hsa-miR-3132	CLIP-seq
MIRT1291682	hsa-miR-3175	CLIP-seq
MIRT2086773	hsa-miR-3192	CLIP-seq
MIRT2086779	hsa-miR-3918	CLIP-seq
MIRT1291688	hsa-miR-3942-5p	CLIP-seq
MIRT2086785	hsa-miR-4314	CLIP-seq
MIRT2086786	hsa-miR-4323	CLIP-seq
MIRT1291693	hsa-miR-4443	CLIP-seq
MIRT1291694	hsa-miR-4450	CLIP-seq
MIRT1291695	hsa-miR-4451	CLIP-seq
MIRT1291696	hsa-miR-4495	CLIP-seq
MIRT1291697	hsa-miR-450b-5p	CLIP-seq
MIRT2086792	hsa-miR-4646-5p	CLIP-seq
MIRT1291700	hsa-miR-4667-5p	CLIP-seq
MIRT1291703	hsa-miR-4700-5p	CLIP-seq
MIRT1291704	hsa-miR-4703-5p	CLIP-seq
MIRT2432445	hsa-miR-4706	CLIP-seq
MIRT2432446	hsa-miR-4749-5p	CLIP-seq
MIRT2432447	hsa-miR-4763-5p	CLIP-seq
MIRT1291711	hsa-miR-4781-5p	CLIP-seq
MIRT2086798	hsa-miR-4786-3p	CLIP-seq
MIRT1291715	hsa-miR-507	CLIP-seq
MIRT1291716	hsa-miR-512-5p	CLIP-seq
MIRT1291717	hsa-miR-518a-5p	CLIP-seq
MIRT1291718	hsa-miR-527	CLIP-seq
MIRT1291719	hsa-miR-545	CLIP-seq
MIRT1291720	hsa-miR-557	CLIP-seq
MIRT2432448	hsa-miR-596	CLIP-seq
MIRT2086802	hsa-miR-622	CLIP-seq
MIRT1291722	hsa-miR-765	CLIP-seq
MIRT1291723	hsa-miR-885-3p	CLIP-seq
MIRT1291724	hsa-miR-96	CLIP-seq
MIRT1291666	hsa-miR-1271	CLIP-seq
MIRT1291669	hsa-miR-182	CLIP-seq
MIRT1291687	hsa-miR-3925-5p	CLIP-seq
MIRT1291690	hsa-miR-4270	CLIP-seq
MIRT1291692	hsa-miR-4441	CLIP-seq
MIRT1291723	hsa-miR-885-3p	CLIP-seq
MIRT1291724	hsa-miR-96	CLIP-seq

Show/Hide all (1)

Transcription factor	Regulation	Reference
JUN	Repression	9377582

Show/Hide all (89)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IBA
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	ISS
GO:0000785	Component	Chromatin	IDA	21131358
GO:0000785	Component	Chromatin	ISA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	ISA
GO:0001843	Process	Neural tube closure	IEA
GO:0002063	Process	Chondrocyte development	IEA
GO:0002068	Process	Glandular epithelial cell development	IEA
GO:0003417	Process	Growth plate cartilage development	IEA
GO:0003430	Process	Growth plate cartilage chondrocyte growth	IEA
GO:0003677	Function	DNA binding	IEA
GO:0003677	Function	DNA binding	ISS
GO:0003682	Function	Chromatin binding	IEA
GO:0003700	Function	DNA-binding transcription factor activity	IEA
GO:0003700	Function	DNA-binding transcription factor activity	ISS
GO:0004879	Function	Nuclear receptor activity	IBA
GO:0004879	Function	Nuclear receptor activity	IEA
GO:0005515	Function	Protein binding	IPI	10428834, 15734736, 16456540, 20413580, 28514442, 32296183, 33961781
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	18845237
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	ISS
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005667	Component	Transcription regulator complex	IEA
GO:0005667	Component	Transcription regulator complex	ISS
GO:0005737	Component	Cytoplasm	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006915	Process	Apoptotic process	IEA
GO:0008270	Function	Zinc ion binding	IEA
GO:0008283	Process	Cell population proliferation	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	IEA
GO:0008285	Process	Negative regulation of cell population proliferation	ISS
GO:0008361	Process	Regulation of cell size	TAS	18438858
GO:0009952	Process	Anterior/posterior pattern specification	IEA
GO:0010468	Process	Regulation of gene expression	IEA
GO:0010628	Process	Positive regulation of gene expression	IEA
GO:0012501	Process	Programmed cell death	IEA
GO:0016020	Component	Membrane	NAS	17943189
GO:0030154	Process	Cell differentiation	IBA
GO:0031076	Process	Embryonic camera-type eye development	IEA
GO:0031641	Process	Regulation of myelination	IEA
GO:0032331	Process	Negative regulation of chondrocyte differentiation	IEA
GO:0032526	Process	Response to retinoic acid	IDA	17943189
GO:0032526	Process	Response to retinoic acid	IEA
GO:0035116	Process	Embryonic hindlimb morphogenesis	IEA
GO:0035116	Process	Embryonic hindlimb morphogenesis	ISS
GO:0035264	Process	Multicellular organism growth	IEA
GO:0043065	Process	Positive regulation of apoptotic process	IEA
GO:0043065	Process	Positive regulation of apoptotic process	ISS
GO:0043068	Process	Positive regulation of programmed cell death	IEA
GO:0043068	Process	Positive regulation of programmed cell death	ISS
GO:0043565	Function	Sequence-specific DNA binding	IEA
GO:0045596	Process	Negative regulation of cell differentiation	IEA
GO:0045637	Process	Regulation of myeloid cell differentiation	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IBA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	ISS
GO:0046872	Function	Metal ion binding	IEA
GO:0046965	Function	Nuclear retinoid X receptor binding	IEA
GO:0046965	Function	Nuclear retinoid X receptor binding	ISS
GO:0048048	Process	Embryonic eye morphogenesis	IEA
GO:0048048	Process	Embryonic eye morphogenesis	ISS
GO:0048384	Process	Retinoic acid receptor signaling pathway	IBA
GO:0048384	Process	Retinoic acid receptor signaling pathway	IDA	17943189
GO:0048384	Process	Retinoic acid receptor signaling pathway	IEA
GO:0048384	Process	Retinoic acid receptor signaling pathway	IEA
GO:0048608	Process	Reproductive structure development	IEA
GO:0048732	Process	Gland development	IEA
GO:0060070	Process	Canonical Wnt signaling pathway	TAS	18484682
GO:0060173	Process	Limb development	IEA
GO:0060324	Process	Face development	IEA
GO:0060348	Process	Bone development	IEA
GO:0060349	Process	Bone morphogenesis	IEA
GO:0060429	Process	Epithelium development	IEA
GO:0060534	Process	Trachea cartilage development	IEA
GO:0060740	Process	Prostate gland epithelium morphogenesis	IEA
GO:0061037	Process	Negative regulation of cartilage development	IEA
GO:0070384	Process	Harderian gland development	IEA
GO:0071300	Process	Cellular response to retinoic acid	IEA
GO:0072089	Process	Stem cell proliferation	IEA
GO:0090575	Component	RNA polymerase II transcription regulator complex	IBA
GO:1990830	Process	Cellular response to leukemia inhibitory factor	IEA
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IEA
GO:2000647	Process	Negative regulation of stem cell proliferation	IEA

MIM	HGNC	e!Ensembl
180190	9866	ENSG00000172819

P13631

Protein name

Retinoic acid receptor gamma (RAR-gamma) (Nuclear receptor subfamily 1 group B member 3)

Protein function

Receptor for retinoic acid. Retinoic acid receptors bind as heterodimers to their target response elements in response to their ligands, all-trans or 9-cis retinoic acid, and regulate gene expression in various biological processes. The RAR/RXR

PDB

1EXA , 1EXX , 1FCX , 1FCY , 1FCZ , 1FD0 , 2LBD , 3LBD , 4LBD , 5M24 , 6FX0

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00105	zf-C4	88 → 157	Zinc finger, C4 type (two domains)	Domain
PF00104	Hormone_recep	226 → 403	Ligand-binding domain of nuclear hormone receptor	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in aortic endothelial cells (at protein level). {ECO:0000269|PubMed:28167758}.

Sequence

MATNKERLFAAGALGPGSGYPGAGFPFAFPGALRGSPPFEMLSPSFRGLGQPDLPKEMAS
LSVETQSTSSEEMVPSSPSPPPPPRVYKPCFVCNDKSSGYHYGVSSCEGCKGFFRRSIQK
NMVYTCHRDKNCIINKVTRNRCQYCRLQKCFEVGMSKEAVRNDRNKKKKEVKEEGSPDSY
ELSPQLEELITKVSKAHQETFPSLCQLGKYTTNSSADHRVQLDLGLWDKFSELATKCIIK
IVEFAKRLPGFTGLSIADQITLLKAACLDILMLRICTRYTPEQDTMTFSDGLTLNRTQMH
NAGFGPLTDLVFAFAGQLLPLEMDDTETGLLSAICLICGDRMDLEEPEKVDKLQEPLLEA
LRLYARRRRPSQPYMFPRMLMKITDLRGISTKGAERAITLKMEIPGPMPPLIREMLENPE
MFEDDSSQPGPHPNASSEDEVPGGQGKGGLKSPA

Sequence length

454

Interactions

View interactions

	Reactome
			Nuclear Receptor transcription pathway Signaling by Retinoic Acid

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (6)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
CLEFT PALATE	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONGENITAL MUSCULOSKELETAL ANOMALIES	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GOUT	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART DISEASES	—	CTD, Disgenet CTD, Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Irido-corneo-trabecular dysgenesis	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (70)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acute Erythroblastic Leukemia	Erythroblastic Leukemia	BEFREE	28552962		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute leukemia	Leukemia	BEFREE	25510432		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Promyelocytic Leukemia	Promyelocytic Leukemia	BEFREE	20935257, 29530751, 30575821, 30996344		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	11231454		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune thyroiditis	Autoimmune Thyroiditis	BEFREE	31579073		★★★★★ ★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	25088254		★★★★★ ★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	Pubtator	20543560	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bile duct carcinoma	Bile duct carcinoma	BEFREE	23798555		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	22920668, 29849791, 8603404		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	22084256	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	38245869	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	28272990	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cartilaginous exostosis	Osteochondroma	BEFREE	31808569		★★★★★ ★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	29713898		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	23798555, 28272990		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	28272990	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	BEFREE	31808569		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	27325643, 28272990		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	28272990, 33472949	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	38245869	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital contractural arachnodactyly	Congenital Contractural Arachnodactyly	BEFREE	23798555		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital musculoskeletal anomalies	Congenital Musculoskeletal Anomalies	CTD_human_DG	9142499		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	23242724	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	28272990	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	22631645	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophagitis	Esotropia	Pubtator	11315258	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrodysplasia Ossificans Progressiva	Fibrodysplasia Ossificans Progressiva	BEFREE	21460849, 28963080		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	26526635		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	26526635	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	26526635		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	26526635	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto Disease	BEFREE	31579073		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Diseases	Heart Diseases	CTD_human_DG	26237429		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Keratoderma, Palmoplantar	Palmoplantar keratoderma	BEFREE	7531539		★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	LHGDN	17252005		★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	23518499, 25510432, 29530751		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	23518499, 25088254	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	23518499, 28696354, 29891591, 33019444, 37387408	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Promyelocytic Acute	Promyelocytic leukemia	Pubtator	12893766, 30996344, 33019444, 35544458, 37387408	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	20935257, 23518499, 30996344, 31709264		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	20197465, 28272990, 28336971		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Childhood Neoplasm	Malignant Neoplasm	BEFREE	26237429		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Childhood Neoplasm	Malignant Neoplasm	GWASCAT_DG	26237429		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	22920668, 29849791, 8603404		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	UNIPROT_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	30120411		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	28336971		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	9228081	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	34411225	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	12174360, 22920668, 25171789, 27325643, 28336971, 31808569, 7630632		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	31170403, 7630632		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	28940647		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	LHGDN	12189556		★★★★★ ★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	23969901, 31579073		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	30120411		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Hyperplasia	Prostatic Hyperplasia	LHGDN	12399530		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Hyperplasia	Prostatic hyperplasia	Pubtator	12399530	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	32881426	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Refractory anemias	Anemia	BEFREE	26416422		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	26416422		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	Pubtator	10424735	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	27992436		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	Pubtator	28696354	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	GWASCAT_DG	31374203		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Skin Diseases	Skin disease	Pubtator	24927175	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	8649863		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	11340568		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	12174360, 28078605	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	22901127	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	37897947	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only

RARG (retinoic acid receptor gamma)