Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	5902
Gene name	RAN binding protein 1
Gene symbol	RANBP1
Synonyms (NCBI Gene)	HTF9A
Chromosome	22
Chromosome location	22q11.21
Summary	This gene encodes a protein that forms a complex with Ras-related nuclear protein (Ran) and metabolizes guanoside triphosphate (GTP). This complex participates in the regulation of the cell cycle by controlling transport of proteins and nucleic acids into

Show/Hide all (46)

miRTarBase ID	miRNA	Experiments	Reference
MIRT050368	hsa-miR-24-3p	CLASH	23622248
MIRT573574	hsa-miR-548c-3p	PAR-CLIP	20371350
MIRT573572	hsa-miR-3662	PAR-CLIP	20371350
MIRT573573	hsa-miR-186-5p	PAR-CLIP	20371350
MIRT573570	hsa-miR-3646	PAR-CLIP	20371350
MIRT573571	hsa-miR-6507-5p	PAR-CLIP	20371350
MIRT573569	hsa-miR-5584-3p	PAR-CLIP	20371350
MIRT573568	hsa-miR-410-3p	PAR-CLIP	20371350
MIRT573567	hsa-miR-584-3p	PAR-CLIP	20371350
MIRT573566	hsa-miR-4277	PAR-CLIP	20371350
MIRT573565	hsa-miR-4780	PAR-CLIP	20371350
MIRT573564	hsa-miR-6780b-3p	PAR-CLIP	20371350
MIRT573563	hsa-miR-190a-3p	PAR-CLIP	20371350
MIRT573562	hsa-miR-623	PAR-CLIP	20371350
MIRT573561	hsa-miR-6083	PAR-CLIP	20371350
MIRT573574	hsa-miR-548c-3p	PAR-CLIP	20371350
MIRT573572	hsa-miR-3662	PAR-CLIP	20371350
MIRT573573	hsa-miR-186-5p	PAR-CLIP	20371350
MIRT573570	hsa-miR-3646	PAR-CLIP	20371350
MIRT573571	hsa-miR-6507-5p	PAR-CLIP	20371350
MIRT573569	hsa-miR-5584-3p	PAR-CLIP	20371350
MIRT573568	hsa-miR-410-3p	PAR-CLIP	20371350
MIRT573567	hsa-miR-584-3p	PAR-CLIP	20371350
MIRT573566	hsa-miR-4277	PAR-CLIP	20371350
MIRT573565	hsa-miR-4780	PAR-CLIP	20371350
MIRT573564	hsa-miR-6780b-3p	PAR-CLIP	20371350
MIRT573563	hsa-miR-190a-3p	PAR-CLIP	20371350
MIRT573562	hsa-miR-623	PAR-CLIP	20371350
MIRT573561	hsa-miR-6083	PAR-CLIP	20371350
MIRT1289465	hsa-miR-1207-5p	CLIP-seq
MIRT1289466	hsa-miR-186	CLIP-seq
MIRT1289467	hsa-miR-3184	CLIP-seq
MIRT1289468	hsa-miR-410	CLIP-seq
MIRT1289469	hsa-miR-423-5p	CLIP-seq
MIRT1289470	hsa-miR-4688	CLIP-seq
MIRT1289471	hsa-miR-4763-3p	CLIP-seq
MIRT1289472	hsa-miR-486-3p	CLIP-seq
MIRT1289473	hsa-miR-495	CLIP-seq
MIRT1289474	hsa-miR-548ac	CLIP-seq
MIRT1289475	hsa-miR-548ae	CLIP-seq
MIRT1289476	hsa-miR-548aj	CLIP-seq
MIRT1289477	hsa-miR-548am	CLIP-seq
MIRT1289478	hsa-miR-548d-3p	CLIP-seq
MIRT1289479	hsa-miR-548x	CLIP-seq
MIRT1289480	hsa-miR-548z	CLIP-seq
MIRT1289481	hsa-miR-583	CLIP-seq

Show/Hide all (18)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005092	Function	GDP-dissociation inhibitor activity	IMP	7616957
GO:0005096	Function	GTPase activator activity	IBA
GO:0005096	Function	GTPase activator activity	IEA
GO:0005515	Function	Protein binding	IPI	7616957, 16428860
GO:0005634	Component	Nucleus	TAS	16130169
GO:0005635	Component	Nuclear envelope	TAS
GO:0005643	Component	Nuclear pore	IBA
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	25743254
GO:0005737	Component	Cytoplasm	IEA
GO:0005737	Component	Cytoplasm	TAS	16130169
GO:0005813	Component	Centrosome	IBA
GO:0005829	Component	Cytosol	IDA
GO:0006913	Process	Nucleocytoplasmic transport	IEA
GO:0007165	Process	Signal transduction	TAS	7882974, 16130169
GO:0031267	Function	Small GTPase binding	TAS	7882974
GO:0045296	Function	Cadherin binding	HDA	25468996
GO:0046604	Process	Positive regulation of mitotic centrosome separation	IBA

MIM	HGNC	e!Ensembl
601180	9847	ENSG00000099901

P43487

Protein name

Ran-specific GTPase-activating protein (Ran-binding protein 1) (RanBP1)

Protein function

Plays a role in RAN-dependent nucleocytoplasmic transport. Alleviates the TNPO1-dependent inhibition of RAN GTPase activity and mediates the dissociation of RAN from proteins involved in transport into the nucleus (By similarity). Induces a conf

PDB

1K5D , 1K5G

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00638	Ran_BP1	37 → 161	RanBP1 domain	Domain

Sequence

MAAAKDTHEDHDTSTENTDESNHDPQFEPIVSLPEQEIKTLEEDEEELFKMRAKLFRFAS
ENDLPEWKERGTGDVKLLKHKEKGAIRLLMRRDKTLKICANHYITPMMELKPNAGSDRAW
VWNTHADFADECPKPELLAIRFLNAENAQKFKTKFEECRKEIEEREKKAGSGKNDHAEKV
AEKLEALSVKEETKEDAEEKQ

Sequence length

201

Interactions

View interactions

	KEGG		Reactome
	Human T-cell leukemia virus 1 infection Viral carcinogenesis		Rev-mediated nuclear export of HIV RNA

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
KIDNEY NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (17)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Autism Spectrum Disorder	Autism	Pubtator	26781481	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autism Spectrum Disorders	Autism Spectrum Disorder	BEFREE	26781481		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	39457014	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	34201061	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
DiGeorge Syndrome	DiGeorge Syndrome	BEFREE	11804793		★★★★★ ★☆☆☆☆ Found in Text Mining only
DiGeorge Syndrome	Digeorge syndrome	Pubtator	26781481	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	37047826	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	Pubtator	40018934	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Neoplasm	Kidney Neoplasm	CTD_human_DG	28321044		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	37047826	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	UNIPROT_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	CTD_human_DG	28321044		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	26203049		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	21184585		★★★★★ ★☆☆☆☆ Found in Text Mining only
Shprintzen syndrome	Shprintzen Syndrome	BEFREE	11804793		★★★★★ ★☆☆☆☆ Found in Text Mining only
Shprintzen-Goldberg syndrome	Shprintzen-Goldberg Syndrome	BEFREE	11804793		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	26745502	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only

RANBP1 (RAN binding protein 1)