Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	5898
Gene name	RAS like proto-oncogene A
Gene symbol	RALA
Synonyms (NCBI Gene)	HINCONSRAL
Chromosome	7
Chromosome location	7p14.1
Summary	The product of this gene belongs to the small GTPase superfamily, Ras family of proteins. GTP-binding proteins mediate the transmembrane signaling initiated by the occupancy of certain cell surface receptors. This gene encodes a low molecular mass ras-lik

Show/Hide all (1)

SNP ID	Visualize variation	Clinical significance	Consequence
rs1554297905	G>A	Pathogenic, likely-pathogenic	Genic downstream transcript variant, coding sequence variant, missense variant

383

Show/Hide all (383)

miRTarBase ID	miRNA	Experiments	Reference
MIRT006194	hsa-miR-181a-5p	FlowLuciferase reporter assayMicroarrayqRT-PCRWestern blot	22442671
MIRT006194	hsa-miR-181a-5p	Luciferase reporter assayMicroarrayqRT-PCRWestern blot	22442671
MIRT006194	hsa-miR-181a-5p	Luciferase reporter assayMicroarrayqRT-PCRWestern blot	22442671
MIRT006194	hsa-miR-181a-5p	FlowLuciferase reporter assayMicroarrayqRT-PCRWestern blot	22442671
MIRT006194	hsa-miR-181a-5p	Luciferase reporter assayMicroarrayqRT-PCRWestern blot	22442671
MIRT006194	hsa-miR-181a-5p	Luciferase reporter assayMicroarrayqRT-PCRWestern blot	22442671
MIRT006194	hsa-miR-181a-5p	FlowLuciferase reporter assayMicroarrayqRT-PCRWestern blot	22442671
MIRT006194	hsa-miR-181a-5p	Luciferase reporter assayMicroarrayqRT-PCRWestern blot	22442671
MIRT006194	hsa-miR-181a-5p	Luciferase reporter assayMicroarrayqRT-PCRWestern blot	22442671
MIRT030612	hsa-miR-24-3p	Microarray	19748357
MIRT047767	hsa-miR-7-5p	CLASH	23622248
MIRT045096	hsa-miR-186-5p	CLASH	23622248
MIRT045096	hsa-miR-186-5p	CLASH	23622248
MIRT437593	hsa-miR-140-5p	MicroarrayqRT-PCR	22815788
MIRT006194	hsa-miR-181a-5p	MicroarrayqRT-PCR	22815788
MIRT437593	hsa-miR-140-5p	Luciferase reporter assay	24063364
MIRT437593	hsa-miR-140-5p	Luciferase reporter assay	24063364
MIRT437593	hsa-miR-140-5p	Luciferase reporter assayMicroarray	26175215
MIRT1288600	hsa-miR-1	CLIP-seq
MIRT1288601	hsa-miR-103b	CLIP-seq
MIRT1288602	hsa-miR-1178	CLIP-seq
MIRT1288603	hsa-miR-1197	CLIP-seq
MIRT1288604	hsa-miR-141	CLIP-seq
MIRT1288605	hsa-miR-1912	CLIP-seq
MIRT1288606	hsa-miR-197	CLIP-seq
MIRT1288607	hsa-miR-199a-5p	CLIP-seq
MIRT1288608	hsa-miR-199b-5p	CLIP-seq
MIRT1288609	hsa-miR-200a	CLIP-seq
MIRT1288610	hsa-miR-206	CLIP-seq
MIRT1288611	hsa-miR-223	CLIP-seq
MIRT1288612	hsa-miR-296-5p	CLIP-seq
MIRT1288613	hsa-miR-29a	CLIP-seq
MIRT1288614	hsa-miR-29b	CLIP-seq
MIRT1288615	hsa-miR-29c	CLIP-seq
MIRT1288616	hsa-miR-3125	CLIP-seq
MIRT1288617	hsa-miR-3130-5p	CLIP-seq
MIRT1288618	hsa-miR-330-3p	CLIP-seq
MIRT1288619	hsa-miR-337-3p	CLIP-seq
MIRT1288620	hsa-miR-3617	CLIP-seq
MIRT1288621	hsa-miR-3646	CLIP-seq
MIRT1288622	hsa-miR-3673	CLIP-seq
MIRT1288623	hsa-miR-3675-5p	CLIP-seq
MIRT1288624	hsa-miR-3677-5p	CLIP-seq
MIRT1288625	hsa-miR-371-5p	CLIP-seq
MIRT1288626	hsa-miR-371b-5p	CLIP-seq
MIRT1288627	hsa-miR-376a	CLIP-seq
MIRT1288628	hsa-miR-376b	CLIP-seq
MIRT1288629	hsa-miR-3916	CLIP-seq
MIRT1288630	hsa-miR-4328	CLIP-seq
MIRT1288631	hsa-miR-4435	CLIP-seq
MIRT1288632	hsa-miR-4436a	CLIP-seq
MIRT1288633	hsa-miR-4452	CLIP-seq
MIRT1288634	hsa-miR-4477b	CLIP-seq
MIRT1288635	hsa-miR-4482	CLIP-seq
MIRT1288636	hsa-miR-4642	CLIP-seq
MIRT1288637	hsa-miR-4643	CLIP-seq
MIRT1288638	hsa-miR-4659a-3p	CLIP-seq
MIRT1288639	hsa-miR-4659b-3p	CLIP-seq
MIRT1288640	hsa-miR-4666-5p	CLIP-seq
MIRT1288641	hsa-miR-4697-3p	CLIP-seq
MIRT1288642	hsa-miR-4711-5p	CLIP-seq
MIRT1288643	hsa-miR-4712-3p	CLIP-seq
MIRT1288644	hsa-miR-4715-5p	CLIP-seq
MIRT1288645	hsa-miR-4717-3p	CLIP-seq
MIRT1288646	hsa-miR-4731-5p	CLIP-seq
MIRT1288647	hsa-miR-4768-3p	CLIP-seq
MIRT1288648	hsa-miR-4797-3p	CLIP-seq
MIRT1288649	hsa-miR-486-3p	CLIP-seq
MIRT1288650	hsa-miR-539	CLIP-seq
MIRT1288651	hsa-miR-548ac	CLIP-seq
MIRT1288652	hsa-miR-548ae	CLIP-seq
MIRT1288653	hsa-miR-548aj	CLIP-seq
MIRT1288654	hsa-miR-548am	CLIP-seq
MIRT1288655	hsa-miR-548d-3p	CLIP-seq
MIRT1288656	hsa-miR-548x	CLIP-seq
MIRT1288657	hsa-miR-548z	CLIP-seq
MIRT1288658	hsa-miR-613	CLIP-seq
MIRT1288659	hsa-miR-619	CLIP-seq
MIRT1288660	hsa-miR-641	CLIP-seq
MIRT1288661	hsa-miR-642b	CLIP-seq
MIRT1288662	hsa-miR-665	CLIP-seq
MIRT1288663	hsa-miR-885-3p	CLIP-seq
MIRT1552934	hsa-miR-2054	CLIP-seq
MIRT1552935	hsa-miR-4432	CLIP-seq
MIRT1552936	hsa-miR-499-5p	CLIP-seq
MIRT1920846	hsa-miR-192	CLIP-seq
MIRT1920847	hsa-miR-215	CLIP-seq
MIRT1920848	hsa-miR-3661	CLIP-seq
MIRT1920849	hsa-miR-631	CLIP-seq
MIRT1920846	hsa-miR-192	CLIP-seq
MIRT1920847	hsa-miR-215	CLIP-seq
MIRT1920848	hsa-miR-3661	CLIP-seq
MIRT1920849	hsa-miR-631	CLIP-seq
MIRT2085518	hsa-miR-1238	CLIP-seq
MIRT2085519	hsa-miR-1258	CLIP-seq
MIRT2085520	hsa-miR-1291	CLIP-seq
MIRT2085521	hsa-miR-205	CLIP-seq
MIRT1288611	hsa-miR-223	CLIP-seq
MIRT2085522	hsa-miR-224	CLIP-seq
MIRT2085523	hsa-miR-300	CLIP-seq
MIRT2085524	hsa-miR-3117-3p	CLIP-seq
MIRT2085525	hsa-miR-3124-3p	CLIP-seq
MIRT1288616	hsa-miR-3125	CLIP-seq
MIRT2085526	hsa-miR-3156-3p	CLIP-seq
MIRT2085527	hsa-miR-328	CLIP-seq
MIRT1288618	hsa-miR-330-3p	CLIP-seq
MIRT2085528	hsa-miR-3545-3p	CLIP-seq
MIRT2085529	hsa-miR-3545-5p	CLIP-seq
MIRT2085530	hsa-miR-3714	CLIP-seq
MIRT1288625	hsa-miR-371-5p	CLIP-seq
MIRT1288626	hsa-miR-371b-5p	CLIP-seq
MIRT2085531	hsa-miR-381	CLIP-seq
MIRT2085532	hsa-miR-382	CLIP-seq
MIRT1288629	hsa-miR-3916	CLIP-seq
MIRT2085533	hsa-miR-3977	CLIP-seq
MIRT2085534	hsa-miR-4275	CLIP-seq
MIRT2085535	hsa-miR-4286	CLIP-seq
MIRT2085536	hsa-miR-4301	CLIP-seq
MIRT2085537	hsa-miR-4460	CLIP-seq
MIRT2085538	hsa-miR-4666-3p	CLIP-seq
MIRT2085539	hsa-miR-4691-5p	CLIP-seq
MIRT1288641	hsa-miR-4697-3p	CLIP-seq
MIRT2085540	hsa-miR-4704-3p	CLIP-seq
MIRT1288644	hsa-miR-4715-5p	CLIP-seq
MIRT2085541	hsa-miR-4727-3p	CLIP-seq
MIRT2085542	hsa-miR-4728-3p	CLIP-seq
MIRT2085543	hsa-miR-4729	CLIP-seq
MIRT1288648	hsa-miR-4797-3p	CLIP-seq
MIRT2085544	hsa-miR-5096	CLIP-seq
MIRT2085545	hsa-miR-513a-3p	CLIP-seq
MIRT2085546	hsa-miR-532-3p	CLIP-seq
MIRT2085547	hsa-miR-548a-5p	CLIP-seq
MIRT2085548	hsa-miR-548ab	CLIP-seq
MIRT2085549	hsa-miR-548ak	CLIP-seq
MIRT2085550	hsa-miR-548b-5p	CLIP-seq
MIRT2085551	hsa-miR-548c-5p	CLIP-seq
MIRT2085552	hsa-miR-548d-5p	CLIP-seq
MIRT2085553	hsa-miR-548h	CLIP-seq
MIRT2085554	hsa-miR-548i	CLIP-seq
MIRT2085555	hsa-miR-548j	CLIP-seq
MIRT2085556	hsa-miR-548k	CLIP-seq
MIRT2085557	hsa-miR-548l	CLIP-seq
MIRT2085558	hsa-miR-548w	CLIP-seq
MIRT2085559	hsa-miR-548y	CLIP-seq
MIRT2085560	hsa-miR-559	CLIP-seq
MIRT2085561	hsa-miR-579	CLIP-seq
MIRT1288601	hsa-miR-103b	CLIP-seq
MIRT2310830	hsa-miR-1226	CLIP-seq
MIRT2310831	hsa-miR-1245b-3p	CLIP-seq
MIRT2085519	hsa-miR-1258	CLIP-seq
MIRT2310832	hsa-miR-1298	CLIP-seq
MIRT2310833	hsa-miR-1305	CLIP-seq
MIRT2310834	hsa-miR-181a	CLIP-seq
MIRT2310835	hsa-miR-181b	CLIP-seq
MIRT2310836	hsa-miR-181c	CLIP-seq
MIRT2310837	hsa-miR-181d	CLIP-seq
MIRT1288605	hsa-miR-1912	CLIP-seq
MIRT2310838	hsa-miR-214	CLIP-seq
MIRT1288611	hsa-miR-223	CLIP-seq
MIRT2085522	hsa-miR-224	CLIP-seq
MIRT2310839	hsa-miR-2682	CLIP-seq
MIRT2310840	hsa-miR-27a	CLIP-seq
MIRT2310841	hsa-miR-27b	CLIP-seq
MIRT1288613	hsa-miR-29a	CLIP-seq
MIRT1288614	hsa-miR-29b	CLIP-seq
MIRT1288615	hsa-miR-29c	CLIP-seq
MIRT2085524	hsa-miR-3117-3p	CLIP-seq
MIRT1288616	hsa-miR-3125	CLIP-seq
MIRT1288617	hsa-miR-3130-5p	CLIP-seq
MIRT2310842	hsa-miR-3167	CLIP-seq
MIRT2310843	hsa-miR-3173-3p	CLIP-seq
MIRT1288618	hsa-miR-330-3p	CLIP-seq
MIRT2310844	hsa-miR-331-3p	CLIP-seq
MIRT2310845	hsa-miR-338-3p	CLIP-seq
MIRT2310846	hsa-miR-340	CLIP-seq
MIRT2085529	hsa-miR-3545-5p	CLIP-seq
MIRT1288620	hsa-miR-3617	CLIP-seq
MIRT2310847	hsa-miR-3619-3p	CLIP-seq
MIRT2310848	hsa-miR-3619-5p	CLIP-seq
MIRT2310849	hsa-miR-3647-3p	CLIP-seq
MIRT1288624	hsa-miR-3677-5p	CLIP-seq
MIRT2310850	hsa-miR-3680	CLIP-seq
MIRT2085530	hsa-miR-3714	CLIP-seq
MIRT1288625	hsa-miR-371-5p	CLIP-seq
MIRT1288626	hsa-miR-371b-5p	CLIP-seq
MIRT1288627	hsa-miR-376a	CLIP-seq
MIRT1288628	hsa-miR-376b	CLIP-seq
MIRT1288629	hsa-miR-3916	CLIP-seq
MIRT2310851	hsa-miR-3922-5p	CLIP-seq
MIRT2310852	hsa-miR-4262	CLIP-seq
MIRT2310853	hsa-miR-4422	CLIP-seq
MIRT1288632	hsa-miR-4436a	CLIP-seq
MIRT2085537	hsa-miR-4460	CLIP-seq
MIRT1288635	hsa-miR-4482	CLIP-seq
MIRT2310854	hsa-miR-449c	CLIP-seq
MIRT2310855	hsa-miR-450b-5p	CLIP-seq
MIRT2310856	hsa-miR-4530	CLIP-seq
MIRT1288636	hsa-miR-4642	CLIP-seq
MIRT1288641	hsa-miR-4697-3p	CLIP-seq
MIRT1288642	hsa-miR-4711-5p	CLIP-seq
MIRT1288644	hsa-miR-4715-5p	CLIP-seq
MIRT2085541	hsa-miR-4727-3p	CLIP-seq
MIRT2310857	hsa-miR-4733-3p	CLIP-seq
MIRT1288647	hsa-miR-4768-3p	CLIP-seq
MIRT2310858	hsa-miR-4779	CLIP-seq
MIRT1288648	hsa-miR-4797-3p	CLIP-seq
MIRT2310859	hsa-miR-4798-3p	CLIP-seq
MIRT2310860	hsa-miR-498	CLIP-seq
MIRT2310861	hsa-miR-507	CLIP-seq
MIRT2085544	hsa-miR-5096	CLIP-seq
MIRT2085545	hsa-miR-513a-3p	CLIP-seq
MIRT2310862	hsa-miR-513a-5p	CLIP-seq
MIRT2310863	hsa-miR-557	CLIP-seq
MIRT2310864	hsa-miR-591	CLIP-seq
MIRT2310865	hsa-miR-616	CLIP-seq
MIRT1288660	hsa-miR-641	CLIP-seq
MIRT1288662	hsa-miR-665	CLIP-seq
MIRT2310866	hsa-miR-761	CLIP-seq
MIRT2310867	hsa-miR-876-5p	CLIP-seq
MIRT2310868	hsa-miR-936	CLIP-seq
MIRT2457707	hsa-miR-1253	CLIP-seq
MIRT2457708	hsa-miR-1287	CLIP-seq
MIRT2457709	hsa-miR-3143	CLIP-seq
MIRT2457710	hsa-miR-320e	CLIP-seq
MIRT2457711	hsa-miR-4495	CLIP-seq
MIRT2457712	hsa-miR-4764-5p	CLIP-seq
MIRT1288602	hsa-miR-1178	CLIP-seq
MIRT2607297	hsa-miR-135a	CLIP-seq
MIRT2607298	hsa-miR-135b	CLIP-seq
MIRT2607299	hsa-miR-139-5p	CLIP-seq
MIRT1288604	hsa-miR-141	CLIP-seq
MIRT2607300	hsa-miR-146b-3p	CLIP-seq
MIRT2310834	hsa-miR-181a	CLIP-seq
MIRT2310835	hsa-miR-181b	CLIP-seq
MIRT2310836	hsa-miR-181c	CLIP-seq
MIRT2310837	hsa-miR-181d	CLIP-seq
MIRT2607301	hsa-miR-186	CLIP-seq
MIRT1288605	hsa-miR-1912	CLIP-seq
MIRT1288606	hsa-miR-197	CLIP-seq
MIRT1288609	hsa-miR-200a	CLIP-seq
MIRT2607302	hsa-miR-2116	CLIP-seq
MIRT2607303	hsa-miR-216a	CLIP-seq
MIRT2607304	hsa-miR-221	CLIP-seq
MIRT2607305	hsa-miR-222	CLIP-seq
MIRT2607306	hsa-miR-3130-3p	CLIP-seq
MIRT1288617	hsa-miR-3130-5p	CLIP-seq
MIRT2310842	hsa-miR-3167	CLIP-seq
MIRT2310843	hsa-miR-3173-3p	CLIP-seq
MIRT2607307	hsa-miR-3173-5p	CLIP-seq
MIRT2607308	hsa-miR-3180-5p	CLIP-seq
MIRT1288619	hsa-miR-337-3p	CLIP-seq
MIRT2310846	hsa-miR-340	CLIP-seq
MIRT2085528	hsa-miR-3545-3p	CLIP-seq
MIRT2310847	hsa-miR-3619-3p	CLIP-seq
MIRT2310849	hsa-miR-3647-3p	CLIP-seq
MIRT2085532	hsa-miR-382	CLIP-seq
MIRT2607309	hsa-miR-3919	CLIP-seq
MIRT2607310	hsa-miR-3943	CLIP-seq
MIRT2085533	hsa-miR-3977	CLIP-seq
MIRT2607311	hsa-miR-4255	CLIP-seq
MIRT2310852	hsa-miR-4262	CLIP-seq
MIRT2085535	hsa-miR-4286	CLIP-seq
MIRT2607312	hsa-miR-4323	CLIP-seq
MIRT2607313	hsa-miR-4330	CLIP-seq
MIRT1288632	hsa-miR-4436a	CLIP-seq
MIRT2607314	hsa-miR-4464	CLIP-seq
MIRT1288635	hsa-miR-4482	CLIP-seq
MIRT2607315	hsa-miR-4528	CLIP-seq
MIRT1288638	hsa-miR-4659a-3p	CLIP-seq
MIRT1288639	hsa-miR-4659b-3p	CLIP-seq
MIRT1288640	hsa-miR-4666-5p	CLIP-seq
MIRT2607316	hsa-miR-4677-5p	CLIP-seq
MIRT2607317	hsa-miR-4685-5p	CLIP-seq
MIRT2607318	hsa-miR-4726-3p	CLIP-seq
MIRT2607319	hsa-miR-4748	CLIP-seq
MIRT2607320	hsa-miR-4756-3p	CLIP-seq
MIRT2607321	hsa-miR-4758-3p	CLIP-seq
MIRT2607322	hsa-miR-4766-5p	CLIP-seq
MIRT2607323	hsa-miR-4775	CLIP-seq
MIRT2310858	hsa-miR-4779	CLIP-seq
MIRT2607324	hsa-miR-4786-3p	CLIP-seq
MIRT2607325	hsa-miR-4793-3p	CLIP-seq
MIRT2607326	hsa-miR-486-5p	CLIP-seq
MIRT1288650	hsa-miR-539	CLIP-seq
MIRT2607327	hsa-miR-544	CLIP-seq
MIRT2085547	hsa-miR-548a-5p	CLIP-seq
MIRT2085548	hsa-miR-548ab	CLIP-seq
MIRT1288651	hsa-miR-548ac	CLIP-seq
MIRT1288652	hsa-miR-548ae	CLIP-seq
MIRT1288653	hsa-miR-548aj	CLIP-seq
MIRT2085549	hsa-miR-548ak	CLIP-seq
MIRT1288654	hsa-miR-548am	CLIP-seq
MIRT2085550	hsa-miR-548b-5p	CLIP-seq
MIRT2085551	hsa-miR-548c-5p	CLIP-seq
MIRT1288655	hsa-miR-548d-3p	CLIP-seq
MIRT2085552	hsa-miR-548d-5p	CLIP-seq
MIRT2607328	hsa-miR-548g	CLIP-seq
MIRT2085553	hsa-miR-548h	CLIP-seq
MIRT2085554	hsa-miR-548i	CLIP-seq
MIRT2085555	hsa-miR-548j	CLIP-seq
MIRT2085556	hsa-miR-548k	CLIP-seq
MIRT2085557	hsa-miR-548l	CLIP-seq
MIRT2607329	hsa-miR-548v	CLIP-seq
MIRT2085558	hsa-miR-548w	CLIP-seq
MIRT1288656	hsa-miR-548x	CLIP-seq
MIRT2085559	hsa-miR-548y	CLIP-seq
MIRT1288657	hsa-miR-548z	CLIP-seq
MIRT2085560	hsa-miR-559	CLIP-seq
MIRT2310864	hsa-miR-591	CLIP-seq
MIRT2607330	hsa-miR-653	CLIP-seq
MIRT2607331	hsa-miR-676	CLIP-seq
MIRT2607332	hsa-miR-874	CLIP-seq
MIRT2310867	hsa-miR-876-5p	CLIP-seq
MIRT1288602	hsa-miR-1178	CLIP-seq
MIRT2607297	hsa-miR-135a	CLIP-seq
MIRT2607298	hsa-miR-135b	CLIP-seq
MIRT2607299	hsa-miR-139-5p	CLIP-seq
MIRT1288604	hsa-miR-141	CLIP-seq
MIRT2607300	hsa-miR-146b-3p	CLIP-seq
MIRT2310834	hsa-miR-181a	CLIP-seq
MIRT2310835	hsa-miR-181b	CLIP-seq
MIRT2310836	hsa-miR-181c	CLIP-seq
MIRT2310837	hsa-miR-181d	CLIP-seq
MIRT2607301	hsa-miR-186	CLIP-seq
MIRT1288605	hsa-miR-1912	CLIP-seq
MIRT1288606	hsa-miR-197	CLIP-seq
MIRT1288609	hsa-miR-200a	CLIP-seq
MIRT2607302	hsa-miR-2116	CLIP-seq
MIRT2607304	hsa-miR-221	CLIP-seq
MIRT2607305	hsa-miR-222	CLIP-seq
MIRT1288616	hsa-miR-3125	CLIP-seq
MIRT2607306	hsa-miR-3130-3p	CLIP-seq
MIRT1288617	hsa-miR-3130-5p	CLIP-seq
MIRT2310842	hsa-miR-3167	CLIP-seq
MIRT2607307	hsa-miR-3173-5p	CLIP-seq
MIRT2607308	hsa-miR-3180-5p	CLIP-seq
MIRT1288619	hsa-miR-337-3p	CLIP-seq
MIRT2310846	hsa-miR-340	CLIP-seq
MIRT2085528	hsa-miR-3545-3p	CLIP-seq
MIRT2310847	hsa-miR-3619-3p	CLIP-seq
MIRT2310849	hsa-miR-3647-3p	CLIP-seq
MIRT2085532	hsa-miR-382	CLIP-seq
MIRT1288629	hsa-miR-3916	CLIP-seq
MIRT2607310	hsa-miR-3943	CLIP-seq
MIRT2085533	hsa-miR-3977	CLIP-seq
MIRT2607311	hsa-miR-4255	CLIP-seq
MIRT2310852	hsa-miR-4262	CLIP-seq
MIRT2085535	hsa-miR-4286	CLIP-seq
MIRT2607312	hsa-miR-4323	CLIP-seq
MIRT1288632	hsa-miR-4436a	CLIP-seq
MIRT2607314	hsa-miR-4464	CLIP-seq
MIRT1288635	hsa-miR-4482	CLIP-seq
MIRT2607315	hsa-miR-4528	CLIP-seq
MIRT1288638	hsa-miR-4659a-3p	CLIP-seq
MIRT1288639	hsa-miR-4659b-3p	CLIP-seq
MIRT1288640	hsa-miR-4666-5p	CLIP-seq
MIRT2607316	hsa-miR-4677-5p	CLIP-seq
MIRT2607317	hsa-miR-4685-5p	CLIP-seq
MIRT2607318	hsa-miR-4726-3p	CLIP-seq
MIRT2607319	hsa-miR-4748	CLIP-seq
MIRT2607321	hsa-miR-4758-3p	CLIP-seq
MIRT2607322	hsa-miR-4766-5p	CLIP-seq
MIRT2607324	hsa-miR-4786-3p	CLIP-seq
MIRT2607325	hsa-miR-4793-3p	CLIP-seq
MIRT2607326	hsa-miR-486-5p	CLIP-seq
MIRT2689307	hsa-miR-518a-5p	CLIP-seq
MIRT2689308	hsa-miR-527	CLIP-seq
MIRT1288650	hsa-miR-539	CLIP-seq
MIRT2607327	hsa-miR-544	CLIP-seq
MIRT1288651	hsa-miR-548ac	CLIP-seq
MIRT1288652	hsa-miR-548ae	CLIP-seq
MIRT1288653	hsa-miR-548aj	CLIP-seq
MIRT1288654	hsa-miR-548am	CLIP-seq
MIRT1288655	hsa-miR-548d-3p	CLIP-seq
MIRT2607329	hsa-miR-548v	CLIP-seq
MIRT1288656	hsa-miR-548x	CLIP-seq
MIRT1288657	hsa-miR-548z	CLIP-seq
MIRT2689309	hsa-miR-583	CLIP-seq
MIRT2310864	hsa-miR-591	CLIP-seq
MIRT2607330	hsa-miR-653	CLIP-seq
MIRT2607331	hsa-miR-676	CLIP-seq
MIRT2607332	hsa-miR-874	CLIP-seq
MIRT2310867	hsa-miR-876-5p	CLIP-seq

Show/Hide all (58)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0001843	Process	Neural tube closure	IEA
GO:0003924	Function	GTPase activity	IBA
GO:0003924	Function	GTPase activity	IEA
GO:0003924	Function	GTPase activity	IMP	30500825
GO:0003925	Function	G protein activity	IEA
GO:0005515	Function	Protein binding	IPI	7673236, 10051605, 12839989, 16291724, 17540176, 19222999, 19306925, 21241894, 21822277, 24056301, 25241761, 28851898, 30194290, 31980649, 34480001
GO:0005525	Function	GTP binding	IBA
GO:0005525	Function	GTP binding	IDA	24056301
GO:0005525	Function	GTP binding	IEA
GO:0005525	Function	GTP binding	TAS	2550440
GO:0005739	Component	Mitochondrion	IDA	21822277
GO:0005739	Component	Mitochondrion	IEA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	17875936
GO:0005886	Component	Plasma membrane	IEA
GO:0005925	Component	Focal adhesion	HDA	21423176
GO:0005925	Component	Focal adhesion	IDA
GO:0006887	Process	Exocytosis	IEA
GO:0006935	Process	Chemotaxis	TAS	10848592
GO:0007165	Process	Signal transduction	IEA
GO:0007165	Process	Signal transduction	TAS	2550440, 10848592
GO:0007265	Process	Ras protein signal transduction	IBA
GO:0007265	Process	Ras protein signal transduction	IMP	30500825
GO:0009986	Component	Cell surface	IDA	19306925
GO:0016020	Component	Membrane	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0017022	Function	Myosin binding	IPI	24056301
GO:0017157	Process	Regulation of exocytosis	IBA
GO:0017157	Process	Regulation of exocytosis	IDA	20005108
GO:0017157	Process	Regulation of exocytosis	IEA
GO:0019003	Function	GDP binding	IBA
GO:0019003	Function	GDP binding	IDA	24056301
GO:0019003	Function	GDP binding	IEA
GO:0030139	Component	Endocytic vesicle	IDA	19306925
GO:0030659	Component	Cytoplasmic vesicle membrane	TAS
GO:0031623	Process	Receptor internalization	IEA
GO:0031623	Process	Receptor internalization	IGI	34096503
GO:0031625	Function	Ubiquitin protein ligase binding	IPI	24056301
GO:0031755	Function	Edg-2 lysophosphatidic acid receptor binding	IDA	19306925
GO:0032154	Component	Cleavage furrow	IDA	18756269
GO:0032154	Component	Cleavage furrow	IEA
GO:0032956	Process	Regulation of actin cytoskeleton organization	IDA	10051605
GO:0045742	Process	Positive regulation of epidermal growth factor receptor signaling pathway	IEA
GO:0045742	Process	Positive regulation of epidermal growth factor receptor signaling pathway	IGI	34096503
GO:0051117	Function	ATPase binding	IEA
GO:0051117	Function	ATPase binding	IPI	24056301
GO:0051301	Process	Cell division	IEA
GO:0051491	Process	Positive regulation of filopodium assembly	IDA	10051605
GO:0051665	Process	Membrane raft localization	IDA	20005108
GO:0051665	Process	Membrane raft localization	IEA
GO:0070062	Component	Extracellular exosome	HDA	19056867, 19199708, 20458337, 23533145
GO:0072655	Process	Establishment of protein localization to mitochondrion	IMP	21822277
GO:0090141	Process	Positive regulation of mitochondrial fission	IMP	21822277
GO:0090543	Component	Flemming body	IEA
GO:0097060	Component	Synaptic membrane	IEA
GO:0098685	Component	Schaffer collateral - CA1 synapse	IEA
GO:0099149	Process	Regulation of postsynaptic neurotransmitter receptor internalization	IEA

MIM	HGNC	e!Ensembl
179550	9839	ENSG00000006451

P11233

Protein name

Ras-related protein Ral-A (EC 3.6.5.2)

Protein function

Multifunctional GTPase involved in a variety of cellular processes including gene expression, cell migration, cell proliferation, oncogenic transformation and membrane trafficking. Accomplishes its multiple functions by interacting with distinct

PDB

1UAD , 1ZC3 , 1ZC4 , 2A78 , 2A9K , 2BOV , 6P0I , 6P0J , 6P0K , 6P0L , 6P0M , 6P0N , 6P0O , 7NQC , 8FJH , 8FJI

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00071	Ras	16 → 177	Ras family	Domain

Sequence

MAANKPKGQNSLALHKVIMVGSGGVGKSALTLQFMYDEFVEDYEPTKADSYRKKVVLDGE
EVQIDILDTAGQEDYAAIRDNYFRSGEGFLCVFSITEMESFAATADFREQILRVKEDENV
PFLLVGNKSDLEDKRQVSVEEAKNRAEQWNVNYVETSAKTRANVDKVFFDLMREIRARKM
EDSKEKNGKKKRKSLAKRIRERCCIL

Sequence length

206

Interactions

View interactions

	KEGG		Reactome
	Ras signaling pathway Rap1 signaling pathway Phospholipase D signaling pathway Salmonella infection Pathways in cancer Colorectal cancer Pancreatic cancer		Gene and protein expression by JAK-STAT signaling after Interleukin-12 stimulation

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (3)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Hiatt-Neu-Cooper neurodevelopmental syndrome	Pathogenic; Likely pathogenic	rs1554297905, rs2116098628, rs2116098885, rs2116098682, rs2534049677, rs2534049660, rs2534033985, rs2534033999	RCV001380399 RCV001380400 RCV001380401 RCV001775353 RCV002468770 View all (4 more)	★★★★★ ★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Intellectual disability	Likely pathogenic; Pathogenic	rs1554297905	RCV001526588	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Neurodevelopmental delay	Pathogenic	rs2116098893	RCV002274367	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Show/Hide Unknown Diseases (6)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
COMPLEX NEURODEVELOPMENTAL DISORDER	—	ClinGen, GenCC	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DESBUQUOIS SYNDROME	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-SPECIFIC SYNDROMIC INTELLECTUAL DISABILITY	—	Disgenet, Orphanet Disgenet, Orphanet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RALA-related disorder	Uncertain significance; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 1 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (51)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Alzheimer Disease	Alzheimer disease	Pubtator	32614981	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autistic behavior	Autism	CLINVAR_DG	30500825		★★★★★ ★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	LHGDN	17606711		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	19609003, 36229838	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	26152517, 33122623	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	17717605, 19683863, 19822090, 34767674, 36466919	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	20801877, 22331470, 24222664	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	22580611	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	21159665	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	22586063	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinosarcoma	Carcinoma	Pubtator	34745385	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	27979747, 29510205		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	27979747, 29510205		★★★★★ ★☆☆☆☆ Found in Text Mining only
Clinodactyly of the 5th finger	Camptodactyly of fingers	CLINVAR_DG	30500825		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	21199803, 26033452	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Developmental Disabilities	Development Disorder	BEFREE	30500825		★★★★★ ★☆☆☆☆ Found in Text Mining only
Developmental Disabilities	Developmental disability	Pubtator	30500825, 32004447	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Facial Dysmorphism with Multiple Malformations	Facial dysmorphism syndrome	Pubtator	30500825	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Global developmental delay	Developmental Delay	BEFREE	30500825		★★★★★ ★☆☆☆☆ Found in Text Mining only
Global developmental delay	Developmental Delay	GENOMICS_ENGLAND_DG	30500825		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	BEFREE	30500825		★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Intellectual Disability	Mental retardation	GENOMICS_ENGLAND_DG	30500825		★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Intellectual Disability	Intellectual developmental disorder	Pubtator	30500825, 32004447	Associate	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Intestinal Volvulus	Intestinal Volvulus	BEFREE	27387453		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	22580611	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Language Development Disorders	Language development disorders	Pubtator	30500825	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	26554155		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	17717605, 31307202		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Failure	Liver failure	Pubtator	19822090	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	26152517	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	30205046		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	31307202		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	25557115		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	28903407, 31299353		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	25557115, 29196555		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	27979747, 29510205		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	20562921	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Moderate intellectual disability	Mental retardation	CLINVAR_DG	30500825		★★★★★ ★☆☆☆☆ Found in Text Mining only
Monoclonal Gammopathy of Undetermined Significance	Monoclonal Gammapathies	BEFREE	31601693		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	33054056	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	26554155		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	12856001, 24389431, 28903407, 31601693		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	24389431, 25557115, 27149377		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	36817861	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	25557115		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	LHGDN	17174914		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	20801877, 23426533, 29764514	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	28903407, 31299353		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	22586063, 24860838, 27286458	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	19802010		★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	22586063	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

RALA (RAS like proto-oncogene A)