Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	5893
Gene name	RAD52 DNA repair protein
Gene symbol	RAD52
Synonyms (NCBI Gene)	-
Chromosome	12
Chromosome location	12p13.33
Summary	The protein encoded by this gene shares similarity with Saccharomyces cerevisiae Rad52, a protein important for DNA double-strand break repair and homologous recombination. This gene product was shown to bind single-stranded DNA ends, and mediate the DNA-

200

Show/Hide all (200)

miRTarBase ID	miRNA	Experiments	Reference
MIRT000156	hsa-miR-210-3p	immunoprecipitaionqRT-PCR	19826008
MIRT000156	hsa-miR-210-3p	Luciferase reporter assayqRT-PCRWestern blot	19141645
MIRT000156	hsa-miR-210-3p	Luciferase reporter assayqRT-PCRWestern blot	19141645
MIRT003914	hsa-miR-373-3p	Luciferase reporter assayqRT-PCRWestern blot	19141645
MIRT717823	hsa-miR-3671	HITS-CLIP	19536157
MIRT717822	hsa-miR-607	HITS-CLIP	19536157
MIRT000156	hsa-miR-210-3p	Western blottingMicroarrayImmunoprecipitaion (IP)qRT-PCRImmunocytochemistry (ICC)	31468617
MIRT717823	hsa-miR-3671	HITS-CLIP	19536157
MIRT717822	hsa-miR-607	HITS-CLIP	19536157
MIRT1288218	hsa-miR-1228	CLIP-seq
MIRT1288219	hsa-miR-124	CLIP-seq
MIRT1288220	hsa-miR-2467-3p	CLIP-seq
MIRT1288221	hsa-miR-29a	CLIP-seq
MIRT1288222	hsa-miR-29b	CLIP-seq
MIRT1288223	hsa-miR-29c	CLIP-seq
MIRT1288224	hsa-miR-330-3p	CLIP-seq
MIRT1288225	hsa-miR-339-5p	CLIP-seq
MIRT1288226	hsa-miR-3714	CLIP-seq
MIRT1288227	hsa-miR-3910	CLIP-seq
MIRT1288228	hsa-miR-4257	CLIP-seq
MIRT1288229	hsa-miR-4645-5p	CLIP-seq
MIRT1288230	hsa-miR-4673	CLIP-seq
MIRT1288231	hsa-miR-4709-5p	CLIP-seq
MIRT1288232	hsa-miR-4733-3p	CLIP-seq
MIRT1288233	hsa-miR-4742-3p	CLIP-seq
MIRT1288234	hsa-miR-506	CLIP-seq
MIRT2085319	hsa-miR-296-5p	CLIP-seq
MIRT2085320	hsa-miR-3136-3p	CLIP-seq
MIRT2085321	hsa-miR-34c-3p	CLIP-seq
MIRT2085322	hsa-miR-3614-5p	CLIP-seq
MIRT2085323	hsa-miR-635	CLIP-seq
MIRT2310760	hsa-miR-1244	CLIP-seq
MIRT2310761	hsa-miR-1298	CLIP-seq
MIRT2310762	hsa-miR-2114	CLIP-seq
MIRT2310763	hsa-miR-338-3p	CLIP-seq
MIRT2310764	hsa-miR-3925-3p	CLIP-seq
MIRT2310765	hsa-miR-433	CLIP-seq
MIRT2310766	hsa-miR-4530	CLIP-seq
MIRT2310767	hsa-miR-4789-5p	CLIP-seq
MIRT2310768	hsa-miR-503	CLIP-seq
MIRT2310769	hsa-miR-515-5p	CLIP-seq
MIRT2310770	hsa-miR-766	CLIP-seq
MIRT1288218	hsa-miR-1228	CLIP-seq
MIRT2393419	hsa-miR-128	CLIP-seq
MIRT2393420	hsa-miR-24	CLIP-seq
MIRT1288225	hsa-miR-339-5p	CLIP-seq
MIRT2393421	hsa-miR-342-3p	CLIP-seq
MIRT2393422	hsa-miR-4284	CLIP-seq
MIRT1288233	hsa-miR-4742-3p	CLIP-seq
MIRT2457698	hsa-miR-3148	CLIP-seq
MIRT2457699	hsa-miR-3647-3p	CLIP-seq
MIRT2457700	hsa-miR-3692	CLIP-seq
MIRT2457701	hsa-miR-4795-5p	CLIP-seq
MIRT2607140	hsa-miR-1207-3p	CLIP-seq
MIRT1288218	hsa-miR-1228	CLIP-seq
MIRT1288219	hsa-miR-124	CLIP-seq
MIRT2607141	hsa-miR-185	CLIP-seq
MIRT2607142	hsa-miR-203	CLIP-seq
MIRT2607143	hsa-miR-2110	CLIP-seq
MIRT1288220	hsa-miR-2467-3p	CLIP-seq
MIRT2085319	hsa-miR-296-5p	CLIP-seq
MIRT1288221	hsa-miR-29a	CLIP-seq
MIRT1288222	hsa-miR-29b	CLIP-seq
MIRT1288223	hsa-miR-29c	CLIP-seq
MIRT2607144	hsa-miR-300	CLIP-seq
MIRT2607145	hsa-miR-3127-5p	CLIP-seq
MIRT2085320	hsa-miR-3136-3p	CLIP-seq
MIRT2457698	hsa-miR-3148	CLIP-seq
MIRT2607146	hsa-miR-3194-3p	CLIP-seq
MIRT2607147	hsa-miR-324-5p	CLIP-seq
MIRT1288224	hsa-miR-330-3p	CLIP-seq
MIRT1288225	hsa-miR-339-5p	CLIP-seq
MIRT2085321	hsa-miR-34c-3p	CLIP-seq
MIRT2085322	hsa-miR-3614-5p	CLIP-seq
MIRT2607148	hsa-miR-3622a-3p	CLIP-seq
MIRT2607149	hsa-miR-3622b-3p	CLIP-seq
MIRT2457699	hsa-miR-3647-3p	CLIP-seq
MIRT2607150	hsa-miR-3663-3p	CLIP-seq
MIRT2607151	hsa-miR-3664-5p	CLIP-seq
MIRT2457700	hsa-miR-3692	CLIP-seq
MIRT1288226	hsa-miR-3714	CLIP-seq
MIRT2607152	hsa-miR-381	CLIP-seq
MIRT2607153	hsa-miR-383	CLIP-seq
MIRT1288227	hsa-miR-3910	CLIP-seq
MIRT2607154	hsa-miR-3918	CLIP-seq
MIRT2607155	hsa-miR-3921	CLIP-seq
MIRT2310764	hsa-miR-3925-3p	CLIP-seq
MIRT2607156	hsa-miR-4251	CLIP-seq
MIRT1288228	hsa-miR-4257	CLIP-seq
MIRT2607157	hsa-miR-4271	CLIP-seq
MIRT2607158	hsa-miR-4282	CLIP-seq
MIRT2607159	hsa-miR-4303	CLIP-seq
MIRT2607160	hsa-miR-4306	CLIP-seq
MIRT2607161	hsa-miR-4329	CLIP-seq
MIRT2607162	hsa-miR-4504	CLIP-seq
MIRT2607163	hsa-miR-4539	CLIP-seq
MIRT2607164	hsa-miR-4644	CLIP-seq
MIRT1288229	hsa-miR-4645-5p	CLIP-seq
MIRT2607165	hsa-miR-4653-5p	CLIP-seq
MIRT2607166	hsa-miR-4666-3p	CLIP-seq
MIRT2607167	hsa-miR-4670-5p	CLIP-seq
MIRT1288230	hsa-miR-4673	CLIP-seq
MIRT2607168	hsa-miR-4680-5p	CLIP-seq
MIRT2607169	hsa-miR-4687-5p	CLIP-seq
MIRT1288231	hsa-miR-4709-5p	CLIP-seq
MIRT2607170	hsa-miR-4724-5p	CLIP-seq
MIRT2607171	hsa-miR-4725-3p	CLIP-seq
MIRT1288232	hsa-miR-4733-3p	CLIP-seq
MIRT1288233	hsa-miR-4742-3p	CLIP-seq
MIRT2607172	hsa-miR-4752	CLIP-seq
MIRT2607173	hsa-miR-4762-3p	CLIP-seq
MIRT2607174	hsa-miR-4778-3p	CLIP-seq
MIRT2310767	hsa-miR-4789-5p	CLIP-seq
MIRT2457701	hsa-miR-4795-5p	CLIP-seq
MIRT2607175	hsa-miR-491-3p	CLIP-seq
MIRT1288234	hsa-miR-506	CLIP-seq
MIRT2607176	hsa-miR-507	CLIP-seq
MIRT2607177	hsa-miR-508-5p	CLIP-seq
MIRT2607178	hsa-miR-513a-3p	CLIP-seq
MIRT2607179	hsa-miR-542-3p	CLIP-seq
MIRT2607180	hsa-miR-548ac	CLIP-seq
MIRT2607181	hsa-miR-548ae	CLIP-seq
MIRT2607182	hsa-miR-548aj	CLIP-seq
MIRT2607183	hsa-miR-548am	CLIP-seq
MIRT2607184	hsa-miR-548d-3p	CLIP-seq
MIRT2607185	hsa-miR-548x	CLIP-seq
MIRT2607186	hsa-miR-548z	CLIP-seq
MIRT2607187	hsa-miR-557	CLIP-seq
MIRT2085323	hsa-miR-635	CLIP-seq
MIRT2607188	hsa-miR-767-5p	CLIP-seq
MIRT2607140	hsa-miR-1207-3p	CLIP-seq
MIRT1288218	hsa-miR-1228	CLIP-seq
MIRT1288219	hsa-miR-124	CLIP-seq
MIRT2607141	hsa-miR-185	CLIP-seq
MIRT2607142	hsa-miR-203	CLIP-seq
MIRT2607143	hsa-miR-2110	CLIP-seq
MIRT1288220	hsa-miR-2467-3p	CLIP-seq
MIRT2085319	hsa-miR-296-5p	CLIP-seq
MIRT1288221	hsa-miR-29a	CLIP-seq
MIRT1288222	hsa-miR-29b	CLIP-seq
MIRT1288223	hsa-miR-29c	CLIP-seq
MIRT2607144	hsa-miR-300	CLIP-seq
MIRT2085320	hsa-miR-3136-3p	CLIP-seq
MIRT2457698	hsa-miR-3148	CLIP-seq
MIRT2607146	hsa-miR-3194-3p	CLIP-seq
MIRT2607147	hsa-miR-324-5p	CLIP-seq
MIRT1288224	hsa-miR-330-3p	CLIP-seq
MIRT1288225	hsa-miR-339-5p	CLIP-seq
MIRT2085321	hsa-miR-34c-3p	CLIP-seq
MIRT2085322	hsa-miR-3614-5p	CLIP-seq
MIRT2607148	hsa-miR-3622a-3p	CLIP-seq
MIRT2607149	hsa-miR-3622b-3p	CLIP-seq
MIRT2457699	hsa-miR-3647-3p	CLIP-seq
MIRT2607150	hsa-miR-3663-3p	CLIP-seq
MIRT2457700	hsa-miR-3692	CLIP-seq
MIRT1288226	hsa-miR-3714	CLIP-seq
MIRT2607152	hsa-miR-381	CLIP-seq
MIRT2607153	hsa-miR-383	CLIP-seq
MIRT1288227	hsa-miR-3910	CLIP-seq
MIRT2607155	hsa-miR-3921	CLIP-seq
MIRT2607156	hsa-miR-4251	CLIP-seq
MIRT1288228	hsa-miR-4257	CLIP-seq
MIRT2607157	hsa-miR-4271	CLIP-seq
MIRT2607158	hsa-miR-4282	CLIP-seq
MIRT2607159	hsa-miR-4303	CLIP-seq
MIRT2607160	hsa-miR-4306	CLIP-seq
MIRT2607161	hsa-miR-4329	CLIP-seq
MIRT2607163	hsa-miR-4539	CLIP-seq
MIRT2607164	hsa-miR-4644	CLIP-seq
MIRT1288229	hsa-miR-4645-5p	CLIP-seq
MIRT2607165	hsa-miR-4653-5p	CLIP-seq
MIRT2607166	hsa-miR-4666-3p	CLIP-seq
MIRT2607167	hsa-miR-4670-5p	CLIP-seq
MIRT1288230	hsa-miR-4673	CLIP-seq
MIRT2607168	hsa-miR-4680-5p	CLIP-seq
MIRT2607169	hsa-miR-4687-5p	CLIP-seq
MIRT1288231	hsa-miR-4709-5p	CLIP-seq
MIRT2607170	hsa-miR-4724-5p	CLIP-seq
MIRT2607171	hsa-miR-4725-3p	CLIP-seq
MIRT1288232	hsa-miR-4733-3p	CLIP-seq
MIRT1288233	hsa-miR-4742-3p	CLIP-seq
MIRT2607172	hsa-miR-4752	CLIP-seq
MIRT2607173	hsa-miR-4762-3p	CLIP-seq
MIRT2607174	hsa-miR-4778-3p	CLIP-seq
MIRT2310767	hsa-miR-4789-5p	CLIP-seq
MIRT2457701	hsa-miR-4795-5p	CLIP-seq
MIRT2607175	hsa-miR-491-3p	CLIP-seq
MIRT1288234	hsa-miR-506	CLIP-seq
MIRT2607176	hsa-miR-507	CLIP-seq
MIRT2607178	hsa-miR-513a-3p	CLIP-seq
MIRT2607180	hsa-miR-548ac	CLIP-seq
MIRT2607181	hsa-miR-548ae	CLIP-seq
MIRT2607182	hsa-miR-548aj	CLIP-seq
MIRT2607183	hsa-miR-548am	CLIP-seq
MIRT2607184	hsa-miR-548d-3p	CLIP-seq
MIRT2607185	hsa-miR-548x	CLIP-seq
MIRT2607186	hsa-miR-548z	CLIP-seq
MIRT2607187	hsa-miR-557	CLIP-seq
MIRT2085323	hsa-miR-635	CLIP-seq
MIRT2607188	hsa-miR-767-5p	CLIP-seq

Show/Hide all (31)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000724	Process	Double-strand break repair via homologous recombination	IBA
GO:0000724	Process	Double-strand break repair via homologous recombination	IEA
GO:0000724	Process	Double-strand break repair via homologous recombination	IEA
GO:0000730	Process	DNA recombinase assembly	IEA
GO:0003677	Function	DNA binding	IDA	19506022
GO:0003677	Function	DNA binding	IEA
GO:0003677	Function	DNA binding	TAS	7774919
GO:0003697	Function	Single-stranded DNA binding	IMP	12370410
GO:0005515	Function	Protein binding	IPI	8702565, 12750383, 14734547, 17765923, 19338310, 24126761, 32296183
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	19506022
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	TAS	7774919
GO:0005654	Component	Nucleoplasm	TAS
GO:0006281	Process	DNA repair	IEA
GO:0006302	Process	Double-strand break repair	TAS	7774919
GO:0006310	Process	DNA recombination	IEA
GO:0006310	Process	DNA recombination	IMP	8702565, 12370410
GO:0006312	Process	Mitotic recombination	IBA
GO:0006974	Process	DNA damage response	IEA
GO:0010792	Process	DNA double-strand break processing involved in repair via single-strand annealing	IDA	19506022
GO:0010792	Process	DNA double-strand break processing involved in repair via single-strand annealing	IEA
GO:0032991	Component	Protein-containing complex	IDA	19506022
GO:0032993	Component	Protein-DNA complex	IMP	12370410
GO:0034599	Process	Cellular response to oxidative stress	IDA	19506022
GO:0034599	Process	Cellular response to oxidative stress	IEA
GO:0034599	Process	Cellular response to oxidative stress	IEA
GO:0042802	Function	Identical protein binding	IPI	10744977, 12370410, 12750383, 21804533, 32296183
GO:0045002	Process	Double-strand break repair via single-strand annealing	IBA
GO:0045002	Process	Double-strand break repair via single-strand annealing	IEA
GO:2000819	Process	Regulation of nucleotide-excision repair	IDA	19506022

MIM	HGNC	e!Ensembl
600392	9824	ENSG00000002016

P43351

Protein name

DNA repair protein RAD52 homolog

Protein function

Involved in double-stranded break repair. Plays a central role in genetic recombination and DNA repair by promoting the annealing of complementary single-stranded DNA and by stimulation of the RAD51 recombinase. {ECO:0000269|PubMed:12379650, ECO

PDB

1H2I , 1KN0 , 5JRB , 5XRZ , 5XS0 , 8BJM , 8H1P , 8RIL , 8RJ3 , 8RJW , 8TKQ

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF04098	Rad52_Rad22	35 → 183	Rad52/22 family double-strand break repair protein	Family

Sequence

MSGTEEAILGGRDSHPAAGGGSVLCFGQCQYTAEEYQAIQKALRQRLGPEYISSRMAGGG
QKVCYIEGHRVINLANEMFGYNGWAHSITQQNVDFVDLNNGKFYVGVCAFVRVQLKDGSY
HEDVGYGVSEGLKSKALSLEKARKEAVTDGLKRALRSFGNALGNCILDKDYLRSLNKLPR
QLPLEVDLTKAKRQDLEPSVEEARYNSCRPNMALGHPQLQQVTSPSRPSHAVIPADQDCS
SRSLSSSAVESEATHQRKLRQKQLQQQFRERMEKQQVRVSTPSAEKSEAAPPAPPVTHST
PVTVSEPLLEKDFLAGVTQELIKTLEDNSEKWAVTPDAGDGVVKPSSRADPAQTSDTLAL
NNQMVTQNRTPHSVCHQKPQAKSGSWDLQTYSADQRTTGNWESHRKSQDMKKRKYDPS

Sequence length

418

Interactions

View interactions

	KEGG		Reactome
	Homologous recombination		SUMOylation of DNA damage response and repair proteins HDR through Single Strand Annealing (SSA)

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (11)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
CARCINOMA, SQUAMOUS CELL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Congenital myasthenic syndrome 19	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG ADENOCARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RAD52-related disorder	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SMALL CELL LUNG CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SQUAMOUS CELL CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SQUAMOUS CELL LUNG CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UTERINE FIBROID	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (75)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma	Adenocarcinoma	BEFREE	29924316		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	29667179, 30069034		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	10463575, 15958648, 23188672, 25566853, 27974172, 31569559		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Diseases	Breast disease	Pubtator	33275133	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	10507777, 21148102, 26548611, 26873923, 36107942, 37445737, 37578974	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	23836560, 26784987		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Mucoepidermoid	Mucoepidermoid carcinoma	Pubtator	26035306	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	18449888, 22899653, 26013599, 29845285, 29924316		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	GWASCAT_DG	22899653		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	25793373, 29924316, 32401173	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	15670896		★★★★★ ★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	23209746		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	23209746		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chromosomal Instability	Chromosomal instability	Pubtator	22279048	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	18203022		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cockayne Syndrome	Cockayne Syndrome	BEFREE	30297739		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	26735576, 29245274		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	17109495	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	26735576, 29245274	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Differentiated Thyroid Gland Carcinoma	Thyroid Carcinoma	BEFREE	24377596		★★★★★ ★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	15670896		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fanconi Anemia	Fanconi Anemia	BEFREE	30057198		★★★★★ ★☆☆☆☆ Found in Text Mining only
FANCONI ANEMIA, COMPLEMENTATION GROUP A (disorder)	Anemia	BEFREE	30057198		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gallbladder Neoplasms	Gallbladder neoplasm	Pubtator	34106670	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	39273083	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	25012956		★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	29747023		★★★★★ ★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	25793373	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary Breast And Ovarian Cancer Syndrome	BEFREE	12883740		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	35893033	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	19141645	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intestinal Diseases	Intestinal disease	Pubtator	31937549	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	23836560, 29898385		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	37358557	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	32945515	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	24729511, 31719794		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	22382497, 29924316, 36899086	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lung Neoplasms	Lung Neoplasms	CTD_human_DG	26013599		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	24415301		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	29245274	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	29747023		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	10463575, 15958648, 23188672, 25566853, 27974172, 31569559		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	18449888, 22899653, 26013599, 29845285, 29924316		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	GWASDB_DG	22899653		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	CTD_human_DG	26013599		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	15670896		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	19092295		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	12883740, 18449888, 22585853, 24729511, 25012956, 28549257, 28722656, 29523234, 30590106, 31569559		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Squamous Cell Neoplasm	Neoplasm	BEFREE	25793373		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	23209746		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	12376524		★★★★★ ★☆☆☆☆ Found in Text Mining only
Microphthalmia syndromic 7	Microphthalmia	Pubtator	27984745	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mucoepidermoid Carcinoma	Mucoepidermoid Carcinoma	BEFREE	26035306		★★★★★ ★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	23339595		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	23339595	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10362365, 18473729, 23209746, 25793373, 26013599, 26784987, 27923995, 27984746, 28549257, 29898385, 30022024, 31340507, 31381562		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	30868057		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurofibrosarcoma	Neurofibrosarcoma	Pubtator	32590748	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nijmegen Breakage Syndrome	Nijmegen Breakage Syndrome	BEFREE	12066197		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	29845285		★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	15670896		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	26873923, 28591191, 35210412	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	19092295		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polyarteritis Nodosa	Polyarteritis Nodosa	BEFREE	28549257		★★★★★ ★☆☆☆☆ Found in Text Mining only
POLYARTERITIS NODOSA, CHILDHOOD-ONSET	Polyarteritis Nodosa	BEFREE	28549257		★★★★★ ★☆☆☆☆ Found in Text Mining only
Salivary Gland Neoplasms	Salivary gland neoplasms	Pubtator	26035306	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	26013599, 28415565, 29924316		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Squamous cell carcinoma	Carcinoma	CTD_human_DG	26013599		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Squamous cell carcinoma of lung	Lung carcinoma	BEFREE	22585853, 22585858, 25793373		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	19092295		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	19092295		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	LHGDN	19092295		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	24377596	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	24377596	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	23209746	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

RAD52 (RAD52 DNA repair protein)