RAD51 (RAD51 recombinase)

Gene

• Entrez ID: 5888
• Gene name: RAD51 recombinase
• Gene symbol: RAD51
• Synonyms (NCBI Gene): BRCC5, FANCR, HRAD51, HsRad51, HsT16930, MRMV2, RAD51A, RECA
• Chromosome: 15
• Chromosome location: 15q15.1
• Summary: The protein encoded by this gene is a member of the RAD51 protein family. RAD51 family members are highly similar to bacterial RecA and Saccharomyces cerevisiae Rad51, and are known to be involved in the homologous recombination and repair of DNA. This pr

SNPs

SNP ID	Visualize variation	Clinical significance	Consequence
rs34091239	A>-,AA	Pathogenic	Intron variant, frameshift variant, coding sequence variant
rs121917739	G>A	Benign, pathogenic, uncertain-significance	Missense variant, coding sequence variant
rs199925463	C>A,T	Pathogenic	Coding sequence variant, synonymous variant, stop gained
rs1057519413	G>A	Pathogenic	Intron variant, coding sequence variant, missense variant
rs1555429623	G>A	Pathogenic	Missense variant, coding sequence variant
rs1555429629	G>A	Likely-pathogenic	Missense variant, coding sequence variant
rs1555429670	C>T	Likely-pathogenic	Intron variant, missense variant, coding sequence variant

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT003819	hsa-miR-197-3p	Microarray	16822819
MIRT006780	hsa-miR-96-5p	Immunofluorescence, Luciferase reporter assay, qRT-PCR, Western blot	22761336
MIRT016582	hsa-miR-193b-3p	Microarray	20304954
MIRT023031	hsa-miR-124-3p	Microarray	18668037
MIRT024626	hsa-miR-215-5p	Microarray	19074876
MIRT026888	hsa-miR-192-5p	Microarray	19074876
MIRT026888	hsa-miR-192-5p	Sequencing	20371350
MIRT027144	hsa-miR-103a-3p	Sequencing	20371350
MIRT046358	hsa-miR-23b-3p	CLASH	23622248
MIRT038926	hsa-miR-92a-1-5p	CLASH	23622248
MIRT054639	hsa-miR-155-5p	Flow, Immunofluorescence, Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	24616504
MIRT054639	hsa-miR-155-5p	Flow, Immunofluorescence, Immunohistochemistry, Luciferase reporter assay, qRT-PCR, Western blot	24616504
MIRT438601	hsa-miR-221-3p	Western blot	24036252
MIRT027144	hsa-miR-103a-3p	Luciferase reporter assay	24088786
MIRT438264	hsa-miR-107	Luciferase reporter assay	24088786
MIRT438264	hsa-miR-107	Luciferase reporter assay	24088786
MIRT027144	hsa-miR-103a-3p	Luciferase reporter assay	24088786
MIRT438601	hsa-miR-221-3p	Western blot	24036252
MIRT027144	hsa-miR-103a-3p	Luciferase reporter assay	24088786
MIRT438264	hsa-miR-107	Luciferase reporter assay	24088786
MIRT438264	hsa-miR-107	Luciferase reporter assay	24088786
MIRT027144	hsa-miR-103a-3p	Luciferase reporter assay	24088786
MIRT609815	hsa-miR-6858-3p	HITS-CLIP	19536157
MIRT609814	hsa-miR-4676-5p	HITS-CLIP	19536157
MIRT609813	hsa-miR-575	HITS-CLIP	19536157
MIRT609811	hsa-miR-5571-3p	HITS-CLIP	19536157
MIRT609810	hsa-miR-7975	HITS-CLIP	19536157
MIRT609809	hsa-miR-3685	HITS-CLIP	19536157
MIRT609808	hsa-miR-384	HITS-CLIP	19536157
MIRT690932	hsa-miR-6767-3p	HITS-CLIP	23313552
MIRT690931	hsa-miR-5690	HITS-CLIP	23313552
MIRT690930	hsa-miR-6746-5p	HITS-CLIP	23313552
MIRT690929	hsa-miR-214-5p	HITS-CLIP	23313552
MIRT690928	hsa-miR-6811-3p	HITS-CLIP	23313552
MIRT690926	hsa-miR-4294	HITS-CLIP	23313552
MIRT690927	hsa-miR-564	HITS-CLIP	23313552
MIRT690925	hsa-miR-1271-3p	HITS-CLIP	23313552
MIRT690924	hsa-miR-550a-3-5p	HITS-CLIP	23313552
MIRT690923	hsa-miR-550a-5p	HITS-CLIP	23313552
MIRT690922	hsa-miR-891a-3p	HITS-CLIP	23313552
MIRT690921	hsa-miR-7977	HITS-CLIP	23313552
MIRT690920	hsa-miR-6771-5p	HITS-CLIP	23313552
MIRT690919	hsa-miR-6514-3p	HITS-CLIP	23313552
MIRT622530	hsa-miR-6819-3p	HITS-CLIP	23824327
MIRT622529	hsa-miR-6877-3p	HITS-CLIP	23824327
MIRT622528	hsa-miR-4712-5p	HITS-CLIP	23824327
MIRT622527	hsa-miR-770-5p	HITS-CLIP	23824327
MIRT676535	hsa-miR-6840-3p	HITS-CLIP	23824327
MIRT676534	hsa-miR-1915-3p	HITS-CLIP	23824327
MIRT676533	hsa-miR-6764-5p	HITS-CLIP	23824327
MIRT676532	hsa-miR-4726-3p	HITS-CLIP	23824327
MIRT622526	hsa-miR-4722-3p	HITS-CLIP	23824327
MIRT622525	hsa-miR-6727-3p	HITS-CLIP	23824327
MIRT622524	hsa-miR-6747-3p	HITS-CLIP	23824327
MIRT674233	hsa-miR-766-3p	HITS-CLIP	23824327
MIRT674232	hsa-miR-3925-3p	HITS-CLIP	23824327
MIRT622523	hsa-miR-3653-5p	HITS-CLIP	23824327
MIRT622522	hsa-miR-1976	HITS-CLIP	23824327
MIRT622521	hsa-miR-4279	HITS-CLIP	23824327
MIRT676531	hsa-miR-498	HITS-CLIP	23824327
MIRT622530	hsa-miR-6819-3p	HITS-CLIP	23824327
MIRT622529	hsa-miR-6877-3p	HITS-CLIP	23824327
MIRT622528	hsa-miR-4712-5p	HITS-CLIP	23824327
MIRT622527	hsa-miR-770-5p	HITS-CLIP	23824327
MIRT676535	hsa-miR-6840-3p	HITS-CLIP	23824327
MIRT676534	hsa-miR-1915-3p	HITS-CLIP	23824327
MIRT676533	hsa-miR-6764-5p	HITS-CLIP	23824327
MIRT676532	hsa-miR-4726-3p	HITS-CLIP	23824327
MIRT622526	hsa-miR-4722-3p	HITS-CLIP	23824327
MIRT622525	hsa-miR-6727-3p	HITS-CLIP	23824327
MIRT622524	hsa-miR-6747-3p	HITS-CLIP	23824327
MIRT674233	hsa-miR-766-3p	HITS-CLIP	23824327
MIRT674232	hsa-miR-3925-3p	HITS-CLIP	23824327
MIRT622523	hsa-miR-3653-5p	HITS-CLIP	23824327
MIRT622522	hsa-miR-1976	HITS-CLIP	23824327
MIRT622521	hsa-miR-4279	HITS-CLIP	23824327
MIRT676531	hsa-miR-498	HITS-CLIP	23824327
MIRT622530	hsa-miR-6819-3p	HITS-CLIP	23824327
MIRT622529	hsa-miR-6877-3p	HITS-CLIP	23824327
MIRT622528	hsa-miR-4712-5p	HITS-CLIP	23824327
MIRT622527	hsa-miR-770-5p	HITS-CLIP	23824327
MIRT676535	hsa-miR-6840-3p	HITS-CLIP	23824327
MIRT676534	hsa-miR-1915-3p	HITS-CLIP	23824327
MIRT676533	hsa-miR-6764-5p	HITS-CLIP	23824327
MIRT676532	hsa-miR-4726-3p	HITS-CLIP	23824327
MIRT622526	hsa-miR-4722-3p	HITS-CLIP	23824327
MIRT622525	hsa-miR-6727-3p	HITS-CLIP	23824327
MIRT622524	hsa-miR-6747-3p	HITS-CLIP	23824327
MIRT674233	hsa-miR-766-3p	HITS-CLIP	23824327
MIRT674232	hsa-miR-3925-3p	HITS-CLIP	23824327
MIRT622523	hsa-miR-3653-5p	HITS-CLIP	23824327
MIRT622522	hsa-miR-1976	HITS-CLIP	23824327
MIRT622521	hsa-miR-4279	HITS-CLIP	23824327
MIRT676531	hsa-miR-498	HITS-CLIP	23824327
MIRT622530	hsa-miR-6819-3p	HITS-CLIP	23824327
MIRT622529	hsa-miR-6877-3p	HITS-CLIP	23824327
MIRT622528	hsa-miR-4712-5p	HITS-CLIP	23824327
MIRT622527	hsa-miR-770-5p	HITS-CLIP	23824327
MIRT622526	hsa-miR-4722-3p	HITS-CLIP	23824327
MIRT622525	hsa-miR-6727-3p	HITS-CLIP	23824327
MIRT674233	hsa-miR-766-3p	HITS-CLIP	23824327
MIRT674232	hsa-miR-3925-3p	HITS-CLIP	23824327
MIRT622522	hsa-miR-1976	HITS-CLIP	23824327
MIRT609815	hsa-miR-6858-3p	HITS-CLIP	23824327
MIRT609814	hsa-miR-4676-5p	HITS-CLIP	23824327
MIRT609813	hsa-miR-575	HITS-CLIP	23824327
MIRT638374	hsa-miR-4267	HITS-CLIP	23824327
MIRT609812	hsa-miR-4321	HITS-CLIP	23824327
MIRT609811	hsa-miR-5571-3p	HITS-CLIP	23824327
MIRT609810	hsa-miR-7975	HITS-CLIP	23824327
MIRT609809	hsa-miR-3685	HITS-CLIP	23824327
MIRT609808	hsa-miR-384	HITS-CLIP	23824327
MIRT639212	hsa-miR-3675-3p	HITS-CLIP	23824327
MIRT639211	hsa-miR-6849-3p	HITS-CLIP	23824327
MIRT639210	hsa-miR-3190-5p	HITS-CLIP	23824327
MIRT639209	hsa-miR-4786-5p	HITS-CLIP	23824327
MIRT639208	hsa-miR-769-5p	HITS-CLIP	23824327
MIRT639207	hsa-miR-3926	HITS-CLIP	23824327
MIRT639206	hsa-miR-4684-5p	HITS-CLIP	23824327
MIRT639205	hsa-miR-3672	HITS-CLIP	23824327
MIRT639204	hsa-miR-6864-3p	HITS-CLIP	23824327
MIRT639203	hsa-miR-548s	HITS-CLIP	23824327
MIRT635136	hsa-miR-6813-3p	HITS-CLIP	23824327
MIRT635135	hsa-miR-764	HITS-CLIP	23824327
MIRT654496	hsa-miR-3934-5p	HITS-CLIP	23824327
MIRT635134	hsa-miR-1224-3p	HITS-CLIP	23824327
MIRT654495	hsa-miR-212-5p	HITS-CLIP	23824327
MIRT635133	hsa-miR-371b-5p	HITS-CLIP	23824327
MIRT635132	hsa-miR-373-5p	HITS-CLIP	23824327
MIRT635131	hsa-miR-616-5p	HITS-CLIP	23824327
MIRT635130	hsa-miR-371a-5p	HITS-CLIP	23824327
MIRT635129	hsa-miR-372-5p	HITS-CLIP	23824327
MIRT635128	hsa-miR-6790-3p	HITS-CLIP	23824327
MIRT635127	hsa-miR-6821-3p	HITS-CLIP	23824327
MIRT635126	hsa-miR-4454	HITS-CLIP	23824327
MIRT635124	hsa-miR-378a-5p	HITS-CLIP	23824327
MIRT635121	hsa-miR-328-3p	HITS-CLIP	23824327
MIRT609815	hsa-miR-6858-3p	HITS-CLIP	23824327
MIRT609814	hsa-miR-4676-5p	HITS-CLIP	23824327
MIRT609813	hsa-miR-575	HITS-CLIP	23824327
MIRT609811	hsa-miR-5571-3p	HITS-CLIP	23824327
MIRT609810	hsa-miR-7975	HITS-CLIP	23824327
MIRT609809	hsa-miR-3685	HITS-CLIP	23824327
MIRT609808	hsa-miR-384	HITS-CLIP	23824327
MIRT639213	hsa-miR-6771-3p	HITS-CLIP	23824327
MIRT639212	hsa-miR-3675-3p	HITS-CLIP	23824327
MIRT639211	hsa-miR-6849-3p	HITS-CLIP	23824327
MIRT639210	hsa-miR-3190-5p	HITS-CLIP	23824327
MIRT639209	hsa-miR-4786-5p	HITS-CLIP	23824327
MIRT639208	hsa-miR-769-5p	HITS-CLIP	23824327
MIRT639207	hsa-miR-3926	HITS-CLIP	23824327
MIRT639206	hsa-miR-4684-5p	HITS-CLIP	23824327
MIRT639205	hsa-miR-3672	HITS-CLIP	23824327
MIRT639204	hsa-miR-6864-3p	HITS-CLIP	23824327
MIRT639203	hsa-miR-548s	HITS-CLIP	23824327
MIRT609815	hsa-miR-6858-3p	HITS-CLIP	23824327
MIRT609814	hsa-miR-4676-5p	HITS-CLIP	23824327
MIRT609813	hsa-miR-575	HITS-CLIP	23824327
MIRT638374	hsa-miR-4267	HITS-CLIP	23824327
MIRT638373	hsa-miR-6847-3p	HITS-CLIP	23824327
MIRT609812	hsa-miR-4321	HITS-CLIP	23824327
MIRT609811	hsa-miR-5571-3p	HITS-CLIP	23824327
MIRT609810	hsa-miR-7975	HITS-CLIP	23824327
MIRT609809	hsa-miR-3685	HITS-CLIP	23824327
MIRT609808	hsa-miR-384	HITS-CLIP	23824327
MIRT635136	hsa-miR-6813-3p	HITS-CLIP	23824327
MIRT635135	hsa-miR-764	HITS-CLIP	23824327
MIRT635134	hsa-miR-1224-3p	HITS-CLIP	23824327
MIRT635133	hsa-miR-371b-5p	HITS-CLIP	23824327
MIRT635132	hsa-miR-373-5p	HITS-CLIP	23824327
MIRT635131	hsa-miR-616-5p	HITS-CLIP	23824327
MIRT635130	hsa-miR-371a-5p	HITS-CLIP	23824327
MIRT635129	hsa-miR-372-5p	HITS-CLIP	23824327
MIRT622523	hsa-miR-3653-5p	HITS-CLIP	23824327
MIRT635128	hsa-miR-6790-3p	HITS-CLIP	23824327
MIRT635127	hsa-miR-6821-3p	HITS-CLIP	23824327
MIRT635126	hsa-miR-4454	HITS-CLIP	23824327
MIRT635125	hsa-miR-874-5p	HITS-CLIP	23824327
MIRT635124	hsa-miR-378a-5p	HITS-CLIP	23824327
MIRT635123	hsa-miR-513c-5p	HITS-CLIP	23824327
MIRT635122	hsa-miR-514b-5p	HITS-CLIP	23824327
MIRT635121	hsa-miR-328-3p	HITS-CLIP	23824327
MIRT609815	hsa-miR-6858-3p	HITS-CLIP	23824327
MIRT609814	hsa-miR-4676-5p	HITS-CLIP	23824327
MIRT609813	hsa-miR-575	HITS-CLIP	23824327
MIRT609811	hsa-miR-5571-3p	HITS-CLIP	23824327
MIRT609810	hsa-miR-7975	HITS-CLIP	23824327
MIRT609809	hsa-miR-3685	HITS-CLIP	23824327
MIRT609808	hsa-miR-384	HITS-CLIP	23824327
MIRT622530	hsa-miR-6819-3p	HITS-CLIP	23824327
MIRT622529	hsa-miR-6877-3p	HITS-CLIP	23824327
MIRT622528	hsa-miR-4712-5p	HITS-CLIP	23824327
MIRT622527	hsa-miR-770-5p	HITS-CLIP	23824327
MIRT622526	hsa-miR-4722-3p	HITS-CLIP	23824327
MIRT622525	hsa-miR-6727-3p	HITS-CLIP	23824327
MIRT622524	hsa-miR-6747-3p	HITS-CLIP	23824327
MIRT622523	hsa-miR-3653-5p	HITS-CLIP	23824327
MIRT622522	hsa-miR-1976	HITS-CLIP	23824327
MIRT622521	hsa-miR-4279	HITS-CLIP	23824327
MIRT609815	hsa-miR-6858-3p	HITS-CLIP	23824327
MIRT609814	hsa-miR-4676-5p	HITS-CLIP	23824327
MIRT609813	hsa-miR-575	HITS-CLIP	23824327
MIRT609812	hsa-miR-4321	HITS-CLIP	23824327
MIRT609811	hsa-miR-5571-3p	HITS-CLIP	23824327
MIRT609810	hsa-miR-7975	HITS-CLIP	23824327
MIRT609809	hsa-miR-3685	HITS-CLIP	23824327
MIRT609808	hsa-miR-384	HITS-CLIP	23824327
MIRT609815	hsa-miR-6858-3p	HITS-CLIP	23824327
MIRT609814	hsa-miR-4676-5p	HITS-CLIP	23824327
MIRT609813	hsa-miR-575	HITS-CLIP	23824327
MIRT609811	hsa-miR-5571-3p	HITS-CLIP	23824327
MIRT609810	hsa-miR-7975	HITS-CLIP	23824327
MIRT609809	hsa-miR-3685	HITS-CLIP	23824327
MIRT609808	hsa-miR-384	HITS-CLIP	23824327
MIRT609815	hsa-miR-6858-3p	HITS-CLIP	23824327
MIRT609814	hsa-miR-4676-5p	HITS-CLIP	23824327
MIRT609813	hsa-miR-575	HITS-CLIP	23824327
MIRT609812	hsa-miR-4321	HITS-CLIP	23824327
MIRT609811	hsa-miR-5571-3p	HITS-CLIP	23824327
MIRT609810	hsa-miR-7975	HITS-CLIP	23824327
MIRT609809	hsa-miR-3685	HITS-CLIP	23824327
MIRT609808	hsa-miR-384	HITS-CLIP	23824327
MIRT521462	hsa-miR-490-3p	PAR-CLIP	23446348
MIRT521461	hsa-miR-7851-3p	PAR-CLIP	23446348
MIRT521460	hsa-miR-3174	PAR-CLIP	23446348
MIRT521459	hsa-miR-3192-5p	PAR-CLIP	23446348
MIRT521458	hsa-miR-493-3p	PAR-CLIP	23446348
MIRT521457	hsa-miR-7854-3p	PAR-CLIP	23446348
MIRT521456	hsa-miR-219a-1-3p	PAR-CLIP	23446348
MIRT521455	hsa-miR-571	PAR-CLIP	23446348
MIRT521454	hsa-miR-3689d	PAR-CLIP	23446348
MIRT521453	hsa-miR-6851-5p	PAR-CLIP	23446348
MIRT521452	hsa-miR-7106-5p	PAR-CLIP	23446348
MIRT521451	hsa-miR-149-3p	PAR-CLIP	23446348
MIRT521450	hsa-miR-4728-5p	PAR-CLIP	23446348
MIRT521449	hsa-miR-6785-5p	PAR-CLIP	23446348
MIRT521448	hsa-miR-6883-5p	PAR-CLIP	23446348
MIRT521447	hsa-miR-6799-5p	PAR-CLIP	23446348
MIRT521446	hsa-miR-6073	PAR-CLIP	23446348
MIRT521445	hsa-miR-142-3p	PAR-CLIP	23446348
MIRT521444	hsa-miR-921	PAR-CLIP	23446348
MIRT521443	hsa-miR-1273h-5p	PAR-CLIP	23446348
MIRT521442	hsa-miR-30b-3p	PAR-CLIP	23446348
MIRT521441	hsa-miR-3689a-3p	PAR-CLIP	23446348
MIRT521440	hsa-miR-3689b-3p	PAR-CLIP	23446348
MIRT521439	hsa-miR-3689c	PAR-CLIP	23446348
MIRT521438	hsa-miR-6779-5p	PAR-CLIP	23446348
MIRT521437	hsa-miR-6780a-5p	PAR-CLIP	23446348
MIRT453417	hsa-miR-590-3p	PAR-CLIP	23592263
MIRT453416	hsa-miR-6872-3p	PAR-CLIP	23592263
MIRT453415	hsa-miR-4735-5p	PAR-CLIP	23592263
MIRT453414	hsa-miR-4775	PAR-CLIP	23592263
MIRT453413	hsa-miR-3149	PAR-CLIP	23592263
MIRT016582	hsa-miR-193b-3p	ChIP-seq, Luciferase reporter assay, qRT-PCR, Western blot	27225532
MIRT016582	hsa-miR-193b-3p	ChIP-seq, Luciferase reporter assay, qRT-PCR, Western blot	27225532
MIRT016582	hsa-miR-193b-3p	ChIP-seq, Luciferase reporter assay, qRT-PCR, Western blot	27225532
MIRT016582	hsa-miR-193b-3p	ChIP-seq, Luciferase reporter assay, qRT-PCR, Western blot	27225532
MIRT016582	hsa-miR-193b-3p	ChIP-seq, Luciferase reporter assay, qRT-PCR, Western blot	27225532
MIRT016582	hsa-miR-193b-3p	ChIP-seq, Luciferase reporter assay, qRT-PCR, Western blot	27225532
MIRT521454	hsa-miR-3689d	PAR-CLIP	26701625
MIRT521454	hsa-miR-3689d	PAR-CLIP	26701625
MIRT521454	hsa-miR-3689d	PAR-CLIP	26701625
MIRT521453	hsa-miR-6851-5p	PAR-CLIP	26701625
MIRT521453	hsa-miR-6851-5p	PAR-CLIP	26701625
MIRT521453	hsa-miR-6851-5p	PAR-CLIP	26701625
MIRT609815	hsa-miR-6858-3p	HITS-CLIP	19536157
MIRT609814	hsa-miR-4676-5p	HITS-CLIP	19536157
MIRT609813	hsa-miR-575	HITS-CLIP	19536157
MIRT609811	hsa-miR-5571-3p	HITS-CLIP	19536157
MIRT609810	hsa-miR-7975	HITS-CLIP	19536157
MIRT609809	hsa-miR-3685	HITS-CLIP	19536157
MIRT609808	hsa-miR-384	HITS-CLIP	19536157
MIRT690932	hsa-miR-6767-3p	HITS-CLIP	23313552
MIRT690931	hsa-miR-5690	HITS-CLIP	23313552
MIRT690930	hsa-miR-6746-5p	HITS-CLIP	23313552
MIRT690929	hsa-miR-214-5p	HITS-CLIP	23313552
MIRT690928	hsa-miR-6811-3p	HITS-CLIP	23313552
MIRT690926	hsa-miR-4294	HITS-CLIP	23313552
MIRT690927	hsa-miR-564	HITS-CLIP	23313552
MIRT690925	hsa-miR-1271-3p	HITS-CLIP	23313552
MIRT690924	hsa-miR-550a-3-5p	HITS-CLIP	23313552
MIRT690923	hsa-miR-550a-5p	HITS-CLIP	23313552
MIRT690922	hsa-miR-891a-3p	HITS-CLIP	23313552
MIRT690921	hsa-miR-7977	HITS-CLIP	23313552
MIRT690920	hsa-miR-6771-5p	HITS-CLIP	23313552
MIRT690919	hsa-miR-6514-3p	HITS-CLIP	23313552
MIRT622530	hsa-miR-6819-3p	HITS-CLIP	23824327
MIRT622529	hsa-miR-6877-3p	HITS-CLIP	23824327
MIRT622528	hsa-miR-4712-5p	HITS-CLIP	23824327
MIRT622527	hsa-miR-770-5p	HITS-CLIP	23824327
MIRT676535	hsa-miR-6840-3p	HITS-CLIP	23824327
MIRT676534	hsa-miR-1915-3p	HITS-CLIP	23824327
MIRT676533	hsa-miR-6764-5p	HITS-CLIP	23824327
MIRT676532	hsa-miR-4726-3p	HITS-CLIP	23824327
MIRT622526	hsa-miR-4722-3p	HITS-CLIP	23824327
MIRT622525	hsa-miR-6727-3p	HITS-CLIP	23824327
MIRT622524	hsa-miR-6747-3p	HITS-CLIP	23824327
MIRT674233	hsa-miR-766-3p	HITS-CLIP	23824327
MIRT674232	hsa-miR-3925-3p	HITS-CLIP	23824327
MIRT622523	hsa-miR-3653-5p	HITS-CLIP	23824327
MIRT622522	hsa-miR-1976	HITS-CLIP	23824327
MIRT622521	hsa-miR-4279	HITS-CLIP	23824327
MIRT676531	hsa-miR-498	HITS-CLIP	23824327
MIRT622530	hsa-miR-6819-3p	HITS-CLIP	23824327
MIRT622529	hsa-miR-6877-3p	HITS-CLIP	23824327
MIRT622528	hsa-miR-4712-5p	HITS-CLIP	23824327
MIRT622527	hsa-miR-770-5p	HITS-CLIP	23824327
MIRT676535	hsa-miR-6840-3p	HITS-CLIP	23824327
MIRT676534	hsa-miR-1915-3p	HITS-CLIP	23824327
MIRT676533	hsa-miR-6764-5p	HITS-CLIP	23824327
MIRT676532	hsa-miR-4726-3p	HITS-CLIP	23824327
MIRT622526	hsa-miR-4722-3p	HITS-CLIP	23824327
MIRT622525	hsa-miR-6727-3p	HITS-CLIP	23824327
MIRT622524	hsa-miR-6747-3p	HITS-CLIP	23824327
MIRT674233	hsa-miR-766-3p	HITS-CLIP	23824327
MIRT674232	hsa-miR-3925-3p	HITS-CLIP	23824327
MIRT622523	hsa-miR-3653-5p	HITS-CLIP	23824327
MIRT622522	hsa-miR-1976	HITS-CLIP	23824327
MIRT622521	hsa-miR-4279	HITS-CLIP	23824327
MIRT676531	hsa-miR-498	HITS-CLIP	23824327
MIRT622530	hsa-miR-6819-3p	HITS-CLIP	23824327
MIRT622529	hsa-miR-6877-3p	HITS-CLIP	23824327
MIRT622528	hsa-miR-4712-5p	HITS-CLIP	23824327
MIRT622527	hsa-miR-770-5p	HITS-CLIP	23824327
MIRT676535	hsa-miR-6840-3p	HITS-CLIP	23824327
MIRT676534	hsa-miR-1915-3p	HITS-CLIP	23824327
MIRT676533	hsa-miR-6764-5p	HITS-CLIP	23824327
MIRT676532	hsa-miR-4726-3p	HITS-CLIP	23824327
MIRT622526	hsa-miR-4722-3p	HITS-CLIP	23824327
MIRT622525	hsa-miR-6727-3p	HITS-CLIP	23824327
MIRT622524	hsa-miR-6747-3p	HITS-CLIP	23824327
MIRT674233	hsa-miR-766-3p	HITS-CLIP	23824327
MIRT674232	hsa-miR-3925-3p	HITS-CLIP	23824327
MIRT622523	hsa-miR-3653-5p	HITS-CLIP	23824327
MIRT622522	hsa-miR-1976	HITS-CLIP	23824327
MIRT622521	hsa-miR-4279	HITS-CLIP	23824327
MIRT676531	hsa-miR-498	HITS-CLIP	23824327
MIRT622530	hsa-miR-6819-3p	HITS-CLIP	23824327
MIRT622529	hsa-miR-6877-3p	HITS-CLIP	23824327
MIRT622528	hsa-miR-4712-5p	HITS-CLIP	23824327
MIRT622527	hsa-miR-770-5p	HITS-CLIP	23824327
MIRT622526	hsa-miR-4722-3p	HITS-CLIP	23824327
MIRT622525	hsa-miR-6727-3p	HITS-CLIP	23824327
MIRT674233	hsa-miR-766-3p	HITS-CLIP	23824327
MIRT674232	hsa-miR-3925-3p	HITS-CLIP	23824327
MIRT622522	hsa-miR-1976	HITS-CLIP	23824327
MIRT609815	hsa-miR-6858-3p	HITS-CLIP	23824327
MIRT609814	hsa-miR-4676-5p	HITS-CLIP	23824327
MIRT609813	hsa-miR-575	HITS-CLIP	23824327
MIRT638374	hsa-miR-4267	HITS-CLIP	23824327
MIRT609812	hsa-miR-4321	HITS-CLIP	23824327
MIRT609811	hsa-miR-5571-3p	HITS-CLIP	23824327
MIRT609810	hsa-miR-7975	HITS-CLIP	23824327
MIRT609809	hsa-miR-3685	HITS-CLIP	23824327
MIRT609808	hsa-miR-384	HITS-CLIP	23824327
MIRT639212	hsa-miR-3675-3p	HITS-CLIP	23824327
MIRT639211	hsa-miR-6849-3p	HITS-CLIP	23824327
MIRT639210	hsa-miR-3190-5p	HITS-CLIP	23824327
MIRT639209	hsa-miR-4786-5p	HITS-CLIP	23824327
MIRT639208	hsa-miR-769-5p	HITS-CLIP	23824327
MIRT639207	hsa-miR-3926	HITS-CLIP	23824327
MIRT639206	hsa-miR-4684-5p	HITS-CLIP	23824327
MIRT639205	hsa-miR-3672	HITS-CLIP	23824327
MIRT639204	hsa-miR-6864-3p	HITS-CLIP	23824327
MIRT639203	hsa-miR-548s	HITS-CLIP	23824327
MIRT635136	hsa-miR-6813-3p	HITS-CLIP	23824327
MIRT635135	hsa-miR-764	HITS-CLIP	23824327
MIRT654496	hsa-miR-3934-5p	HITS-CLIP	23824327
MIRT635134	hsa-miR-1224-3p	HITS-CLIP	23824327
MIRT654495	hsa-miR-212-5p	HITS-CLIP	23824327
MIRT635133	hsa-miR-371b-5p	HITS-CLIP	23824327
MIRT635132	hsa-miR-373-5p	HITS-CLIP	23824327
MIRT635131	hsa-miR-616-5p	HITS-CLIP	23824327
MIRT635130	hsa-miR-371a-5p	HITS-CLIP	23824327
MIRT635129	hsa-miR-372-5p	HITS-CLIP	23824327
MIRT635128	hsa-miR-6790-3p	HITS-CLIP	23824327
MIRT635127	hsa-miR-6821-3p	HITS-CLIP	23824327
MIRT635126	hsa-miR-4454	HITS-CLIP	23824327
MIRT635124	hsa-miR-378a-5p	HITS-CLIP	23824327
MIRT635121	hsa-miR-328-3p	HITS-CLIP	23824327
MIRT609815	hsa-miR-6858-3p	HITS-CLIP	23824327
MIRT609814	hsa-miR-4676-5p	HITS-CLIP	23824327
MIRT609813	hsa-miR-575	HITS-CLIP	23824327
MIRT609811	hsa-miR-5571-3p	HITS-CLIP	23824327
MIRT609810	hsa-miR-7975	HITS-CLIP	23824327
MIRT609809	hsa-miR-3685	HITS-CLIP	23824327
MIRT609808	hsa-miR-384	HITS-CLIP	23824327
MIRT639213	hsa-miR-6771-3p	HITS-CLIP	23824327
MIRT639212	hsa-miR-3675-3p	HITS-CLIP	23824327
MIRT639211	hsa-miR-6849-3p	HITS-CLIP	23824327
MIRT639210	hsa-miR-3190-5p	HITS-CLIP	23824327
MIRT639209	hsa-miR-4786-5p	HITS-CLIP	23824327
MIRT639208	hsa-miR-769-5p	HITS-CLIP	23824327
MIRT639207	hsa-miR-3926	HITS-CLIP	23824327
MIRT639206	hsa-miR-4684-5p	HITS-CLIP	23824327
MIRT639205	hsa-miR-3672	HITS-CLIP	23824327
MIRT639204	hsa-miR-6864-3p	HITS-CLIP	23824327
MIRT639203	hsa-miR-548s	HITS-CLIP	23824327
MIRT609815	hsa-miR-6858-3p	HITS-CLIP	23824327
MIRT609814	hsa-miR-4676-5p	HITS-CLIP	23824327
MIRT609813	hsa-miR-575	HITS-CLIP	23824327
MIRT638374	hsa-miR-4267	HITS-CLIP	23824327
MIRT638373	hsa-miR-6847-3p	HITS-CLIP	23824327
MIRT609812	hsa-miR-4321	HITS-CLIP	23824327
MIRT609811	hsa-miR-5571-3p	HITS-CLIP	23824327
MIRT609810	hsa-miR-7975	HITS-CLIP	23824327
MIRT609809	hsa-miR-3685	HITS-CLIP	23824327
MIRT609808	hsa-miR-384	HITS-CLIP	23824327
MIRT635136	hsa-miR-6813-3p	HITS-CLIP	23824327
MIRT635135	hsa-miR-764	HITS-CLIP	23824327
MIRT635134	hsa-miR-1224-3p	HITS-CLIP	23824327
MIRT635133	hsa-miR-371b-5p	HITS-CLIP	23824327
MIRT635132	hsa-miR-373-5p	HITS-CLIP	23824327
MIRT635131	hsa-miR-616-5p	HITS-CLIP	23824327
MIRT635130	hsa-miR-371a-5p	HITS-CLIP	23824327
MIRT635129	hsa-miR-372-5p	HITS-CLIP	23824327
MIRT622523	hsa-miR-3653-5p	HITS-CLIP	23824327
MIRT635128	hsa-miR-6790-3p	HITS-CLIP	23824327
MIRT635127	hsa-miR-6821-3p	HITS-CLIP	23824327
MIRT635126	hsa-miR-4454	HITS-CLIP	23824327
MIRT635125	hsa-miR-874-5p	HITS-CLIP	23824327
MIRT635124	hsa-miR-378a-5p	HITS-CLIP	23824327
MIRT635123	hsa-miR-513c-5p	HITS-CLIP	23824327
MIRT635122	hsa-miR-514b-5p	HITS-CLIP	23824327
MIRT635121	hsa-miR-328-3p	HITS-CLIP	23824327
MIRT609815	hsa-miR-6858-3p	HITS-CLIP	23824327
MIRT609814	hsa-miR-4676-5p	HITS-CLIP	23824327
MIRT609813	hsa-miR-575	HITS-CLIP	23824327
MIRT609811	hsa-miR-5571-3p	HITS-CLIP	23824327
MIRT609810	hsa-miR-7975	HITS-CLIP	23824327
MIRT609809	hsa-miR-3685	HITS-CLIP	23824327
MIRT609808	hsa-miR-384	HITS-CLIP	23824327
MIRT622530	hsa-miR-6819-3p	HITS-CLIP	23824327
MIRT622529	hsa-miR-6877-3p	HITS-CLIP	23824327
MIRT622528	hsa-miR-4712-5p	HITS-CLIP	23824327
MIRT622527	hsa-miR-770-5p	HITS-CLIP	23824327
MIRT622526	hsa-miR-4722-3p	HITS-CLIP	23824327
MIRT622525	hsa-miR-6727-3p	HITS-CLIP	23824327
MIRT622524	hsa-miR-6747-3p	HITS-CLIP	23824327
MIRT622523	hsa-miR-3653-5p	HITS-CLIP	23824327
MIRT622522	hsa-miR-1976	HITS-CLIP	23824327
MIRT622521	hsa-miR-4279	HITS-CLIP	23824327
MIRT609815	hsa-miR-6858-3p	HITS-CLIP	23824327
MIRT609814	hsa-miR-4676-5p	HITS-CLIP	23824327
MIRT609813	hsa-miR-575	HITS-CLIP	23824327
MIRT609812	hsa-miR-4321	HITS-CLIP	23824327
MIRT609811	hsa-miR-5571-3p	HITS-CLIP	23824327
MIRT609810	hsa-miR-7975	HITS-CLIP	23824327
MIRT609809	hsa-miR-3685	HITS-CLIP	23824327
MIRT609808	hsa-miR-384	HITS-CLIP	23824327
MIRT609815	hsa-miR-6858-3p	HITS-CLIP	23824327
MIRT609814	hsa-miR-4676-5p	HITS-CLIP	23824327
MIRT609813	hsa-miR-575	HITS-CLIP	23824327
MIRT609811	hsa-miR-5571-3p	HITS-CLIP	23824327
MIRT609810	hsa-miR-7975	HITS-CLIP	23824327
MIRT609809	hsa-miR-3685	HITS-CLIP	23824327
MIRT609808	hsa-miR-384	HITS-CLIP	23824327
MIRT609815	hsa-miR-6858-3p	HITS-CLIP	23824327
MIRT609814	hsa-miR-4676-5p	HITS-CLIP	23824327
MIRT609813	hsa-miR-575	HITS-CLIP	23824327
MIRT609812	hsa-miR-4321	HITS-CLIP	23824327
MIRT609811	hsa-miR-5571-3p	HITS-CLIP	23824327
MIRT609810	hsa-miR-7975	HITS-CLIP	23824327
MIRT609809	hsa-miR-3685	HITS-CLIP	23824327
MIRT609808	hsa-miR-384	HITS-CLIP	23824327
MIRT521462	hsa-miR-490-3p	PAR-CLIP	23446348
MIRT521461	hsa-miR-7851-3p	PAR-CLIP	23446348
MIRT521460	hsa-miR-3174	PAR-CLIP	23446348
MIRT521459	hsa-miR-3192-5p	PAR-CLIP	23446348
MIRT521458	hsa-miR-493-3p	PAR-CLIP	23446348
MIRT521457	hsa-miR-7854-3p	PAR-CLIP	23446348
MIRT521456	hsa-miR-219a-1-3p	PAR-CLIP	23446348
MIRT521455	hsa-miR-571	PAR-CLIP	23446348
MIRT521454	hsa-miR-3689d	PAR-CLIP	23446348
MIRT521453	hsa-miR-6851-5p	PAR-CLIP	23446348
MIRT521452	hsa-miR-7106-5p	PAR-CLIP	23446348
MIRT521451	hsa-miR-149-3p	PAR-CLIP	23446348
MIRT521450	hsa-miR-4728-5p	PAR-CLIP	23446348
MIRT521449	hsa-miR-6785-5p	PAR-CLIP	23446348
MIRT521448	hsa-miR-6883-5p	PAR-CLIP	23446348
MIRT521447	hsa-miR-6799-5p	PAR-CLIP	23446348
MIRT521446	hsa-miR-6073	PAR-CLIP	23446348
MIRT521445	hsa-miR-142-3p	PAR-CLIP	23446348
MIRT521444	hsa-miR-921	PAR-CLIP	23446348
MIRT521443	hsa-miR-1273h-5p	PAR-CLIP	23446348
MIRT521442	hsa-miR-30b-3p	PAR-CLIP	23446348
MIRT521441	hsa-miR-3689a-3p	PAR-CLIP	23446348
MIRT521440	hsa-miR-3689b-3p	PAR-CLIP	23446348
MIRT521439	hsa-miR-3689c	PAR-CLIP	23446348
MIRT521438	hsa-miR-6779-5p	PAR-CLIP	23446348
MIRT521437	hsa-miR-6780a-5p	PAR-CLIP	23446348
MIRT453417	hsa-miR-590-3p	PAR-CLIP	23592263
MIRT453416	hsa-miR-6872-3p	PAR-CLIP	23592263
MIRT453415	hsa-miR-4735-5p	PAR-CLIP	23592263
MIRT453414	hsa-miR-4775	PAR-CLIP	23592263
MIRT453413	hsa-miR-3149	PAR-CLIP	23592263
MIRT755772	hsa-miR-4796-3p	Luciferase reporter assay, Western blotting, qRT-PCR, in vitro cullelar assays, GFP reporter assay	37460775
MIRT1287954	hsa-miR-124	CLIP-seq
MIRT1287955	hsa-miR-132	CLIP-seq
MIRT1287956	hsa-miR-194	CLIP-seq
MIRT1287957	hsa-miR-198	CLIP-seq
MIRT1287958	hsa-miR-212	CLIP-seq
MIRT1287959	hsa-miR-3144-3p	CLIP-seq
MIRT1287960	hsa-miR-3179	CLIP-seq
MIRT1287961	hsa-miR-320a	CLIP-seq
MIRT1287962	hsa-miR-320b	CLIP-seq
MIRT1287963	hsa-miR-320c	CLIP-seq
MIRT1287964	hsa-miR-320d	CLIP-seq
MIRT1287965	hsa-miR-3657	CLIP-seq
MIRT1287966	hsa-miR-369-3p	CLIP-seq
MIRT1287967	hsa-miR-3714	CLIP-seq
MIRT1287968	hsa-miR-374a	CLIP-seq
MIRT1287969	hsa-miR-374b	CLIP-seq
MIRT1287970	hsa-miR-3910	CLIP-seq
MIRT1287971	hsa-miR-3927	CLIP-seq
MIRT1287972	hsa-miR-4302	CLIP-seq
MIRT1287973	hsa-miR-4429	CLIP-seq
MIRT1287974	hsa-miR-4667-3p	CLIP-seq
MIRT1287975	hsa-miR-4669	CLIP-seq
MIRT1287976	hsa-miR-4691-5p	CLIP-seq
MIRT1287977	hsa-miR-485-3p	CLIP-seq
MIRT1287978	hsa-miR-506	CLIP-seq
MIRT1287979	hsa-miR-548aa	CLIP-seq
MIRT1287980	hsa-miR-570	CLIP-seq
MIRT1287981	hsa-miR-767-5p	CLIP-seq
MIRT1287982	hsa-miR-2117	CLIP-seq
MIRT1287983	hsa-miR-3168	CLIP-seq
MIRT1287984	hsa-miR-432	CLIP-seq
MIRT1287985	hsa-miR-4753-3p	CLIP-seq
MIRT1287986	hsa-miR-766	CLIP-seq
MIRT1287977	hsa-miR-485-3p	CLIP-seq
MIRT2085294	hsa-miR-4772-3p	CLIP-seq
MIRT2085295	hsa-miR-891b	CLIP-seq
MIRT2085296	hsa-miR-134	CLIP-seq
MIRT2085297	hsa-miR-3118	CLIP-seq
MIRT2085298	hsa-miR-3164	CLIP-seq
MIRT2085299	hsa-miR-4328	CLIP-seq
MIRT2085300	hsa-miR-4760-5p	CLIP-seq
MIRT2085301	hsa-miR-758	CLIP-seq
MIRT2310736	hsa-miR-1234	CLIP-seq
MIRT2310737	hsa-miR-1343	CLIP-seq
MIRT2310738	hsa-miR-378g	CLIP-seq
MIRT2310739	hsa-miR-4437	CLIP-seq
MIRT2310740	hsa-miR-4674	CLIP-seq
MIRT2393398	hsa-miR-130a	CLIP-seq
MIRT2393399	hsa-miR-130b	CLIP-seq
MIRT2393400	hsa-miR-148a	CLIP-seq
MIRT2393401	hsa-miR-148b	CLIP-seq
MIRT2393402	hsa-miR-152	CLIP-seq
MIRT2393403	hsa-miR-301a	CLIP-seq
MIRT2393404	hsa-miR-301b	CLIP-seq
MIRT2393405	hsa-miR-3666	CLIP-seq
MIRT2393406	hsa-miR-3680	CLIP-seq
MIRT2393407	hsa-miR-4295	CLIP-seq
MIRT2393408	hsa-miR-4431	CLIP-seq
MIRT2393409	hsa-miR-454	CLIP-seq
MIRT2085294	hsa-miR-4772-3p	CLIP-seq
MIRT2085295	hsa-miR-891b	CLIP-seq
MIRT1287960	hsa-miR-3179	CLIP-seq
MIRT1287971	hsa-miR-3927	CLIP-seq
MIRT1287960	hsa-miR-3179	CLIP-seq
MIRT1287971	hsa-miR-3927	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
BRCA2	Unknown	12967658;17515904;19628690;20729859
CREBBP	Unknown	23285190
E2F1	Unknown	23285190
E2F4	Repression	20133863;21701264
E2F4	Unknown	17001309
EP300	Unknown	23285190
HSF4	Unknown	22587838
MEN1	Unknown	23648481
RBL2	Repression	21701264

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000150	Function	DNA strand exchange activity	IBA
GO:0000150	Function	DNA strand exchange activity	IDA	18417535
GO:0000150	Function	DNA strand exchange activity	IEA
GO:0000152	Component	Nuclear ubiquitin ligase complex	IDA	14636569
GO:0000166	Function	Nucleotide binding	IEA
GO:0000228	Component	Nuclear chromosome	IDA	23754376
GO:0000722	Process	Telomere maintenance via recombination	IEA
GO:0000722	Process	Telomere maintenance via recombination	ISS	21076401
GO:0000724	Process	Double-strand break repair via homologous recombination	IDA	16428451
GO:0000724	Process	Double-strand break repair via homologous recombination	IDA	17996710, 17996711, 18417535, 26811421, 27239033, 32640219
GO:0000724	Process	Double-strand break repair via homologous recombination	IEA
GO:0000724	Process	Double-strand break repair via homologous recombination	IEA
GO:0000724	Process	Double-strand break repair via homologous recombination	IMP	22778135, 23509288, 26681308
GO:0000724	Process	Double-strand break repair via homologous recombination	TAS	12427746
GO:0000730	Process	DNA recombinase assembly	IBA
GO:0000730	Process	DNA recombinase assembly	IMP	26681308
GO:0000781	Component	Chromosome, telomeric region	IDA	21076401
GO:0000781	Component	Chromosome, telomeric region	IEA
GO:0000785	Component	Chromatin	IDA	25585578, 26323318
GO:0000793	Component	Condensed chromosome	IEA
GO:0000793	Component	Condensed chromosome	ISS
GO:0000794	Component	Condensed nuclear chromosome	IBA
GO:0000794	Component	Condensed nuclear chromosome	IEA
GO:0000794	Component	Condensed nuclear chromosome	ISS
GO:0000800	Component	Lateral element	IDA	9774970
GO:0000800	Component	Lateral element	IEA
GO:0001673	Component	Male germ cell nucleus	IEA
GO:0003677	Function	DNA binding	IEA
GO:0003682	Function	Chromatin binding	IDA	23401855
GO:0003682	Function	Chromatin binding	IEA
GO:0003690	Function	Double-stranded DNA binding	IBA
GO:0003690	Function	Double-stranded DNA binding	IDA	7988572
GO:0003690	Function	Double-stranded DNA binding	IEA
GO:0003690	Function	Double-stranded DNA binding	IMP	26681308
GO:0003697	Function	Single-stranded DNA binding	IBA
GO:0003697	Function	Single-stranded DNA binding	IDA	7988572
GO:0003697	Function	Single-stranded DNA binding	IEA
GO:0003697	Function	Single-stranded DNA binding	IMP	26681308
GO:0005515	Function	Protein binding	IPI	8675009, 9380510, 9396801, 9461559, 9560268, 9660962, 10551859, 11309417, 11842113, 12242698, 12442171, 12750383, 15665856, 15800615, 16186822, 16395335, 16756962, 16990250, 17515903, 17515904, 17541404, 17996710, 17996711, 18264088, 19303847, 19338310, 19628690, 20154705, 20729832
GO:0005524	Function	ATP binding	IDA	16428451
GO:0005524	Function	ATP binding	IEA
GO:0005634	Component	Nucleus	IDA	12442171, 14636569, 16215984, 18417535, 25585578, 26323318, 26681308, 26833090
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	ISS
GO:0005654	Component	Nucleoplasm	TAS
GO:0005694	Component	Chromosome	IEA
GO:0005730	Component	Nucleolus	IDA
GO:0005737	Component	Cytoplasm	IDA	16215984, 25585578, 26681308
GO:0005737	Component	Cytoplasm	IEA
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IDA	20413593
GO:0005739	Component	Mitochondrion	IEA
GO:0005759	Component	Mitochondrial matrix	IEA
GO:0005813	Component	Centrosome	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005856	Component	Cytoskeleton	IEA
GO:0006259	Process	DNA metabolic process	IEA
GO:0006281	Process	DNA repair	IEA
GO:0006281	Process	DNA repair	TAS	8358431
GO:0006310	Process	DNA recombination	IDA	8929543
GO:0006310	Process	DNA recombination	IEA
GO:0006310	Process	DNA recombination	TAS	7988572
GO:0006312	Process	Mitotic recombination	IBA
GO:0006312	Process	Mitotic recombination	TAS	8358431
GO:0006974	Process	DNA damage response	IDA	17996710, 17996711, 23509288, 25585578, 27239033
GO:0006974	Process	DNA damage response	IEA
GO:0006974	Process	DNA damage response	IMP	26681308
GO:0007127	Process	Meiosis I	IEA
GO:0007131	Process	Reciprocal meiotic recombination	IBA
GO:0007131	Process	Reciprocal meiotic recombination	IEA
GO:0007131	Process	Reciprocal meiotic recombination	TAS	8358431
GO:0008094	Function	ATP-dependent activity, acting on DNA	IBA
GO:0008094	Function	ATP-dependent activity, acting on DNA	IEA
GO:0009410	Process	Response to xenobiotic stimulus	IEA
GO:0009636	Process	Response to toxic substance	IEA
GO:0010165	Process	Response to X-ray	IEA
GO:0010569	Process	Regulation of double-strand break repair via homologous recombination	IDA	23754376
GO:0010833	Process	Telomere maintenance via telomere lengthening	IEA
GO:0010833	Process	Telomere maintenance via telomere lengthening	ISS	21076401
GO:0016605	Component	PML body	IDA	11309417
GO:0017116	Function	Single-stranded DNA helicase activity	IDA	7988572, 8929543
GO:0017116	Function	Single-stranded DNA helicase activity	IMP	26681308
GO:0019899	Function	Enzyme binding	IPI	23401855
GO:0031297	Process	Replication fork processing	IDA	18417535, 25585578
GO:0031297	Process	Replication fork processing	IEA
GO:0031297	Process	Replication fork processing	IMP	22778135
GO:0032200	Process	Telomere organization	IEA
GO:0032991	Component	Protein-containing complex	IDA	16990250, 26833090
GO:0035861	Component	Site of double-strand break	IDA	26811421, 27797818
GO:0035861	Component	Site of double-strand break	IDA	24550317
GO:0035861	Component	Site of double-strand break	IEA
GO:0036297	Process	Interstrand cross-link repair	IMP	26253028
GO:0042148	Process	DNA strand invasion	IBA
GO:0042802	Function	Identical protein binding	IPI	9396801, 9469824, 9660962, 12442171, 17515903, 17515904, 19622740, 19628690, 25282148, 27941862, 28864920
GO:0048471	Component	Perinuclear region of cytoplasm	IDA	16215984
GO:0048471	Component	Perinuclear region of cytoplasm	IEA
GO:0051321	Process	Meiotic cell cycle	IEA
GO:0051321	Process	Meiotic cell cycle	ISS
GO:0070182	Function	DNA polymerase binding	IPI	19995904
GO:0070192	Process	Chromosome organization involved in meiotic cell cycle	IBA
GO:0070192	Process	Chromosome organization involved in meiotic cell cycle	IEA
GO:0071312	Process	Cellular response to alkaloid	IEA
GO:0071479	Process	Cellular response to ionizing radiation	IDA	23509288, 23754376
GO:0071479	Process	Cellular response to ionizing radiation	IMP	14636569
GO:0071480	Process	Cellular response to gamma radiation	IEA
GO:0072711	Process	Cellular response to hydroxyurea	IEA
GO:0072719	Process	Cellular response to cisplatin	IEA
GO:0072757	Process	Cellular response to camptothecin	IDA	23509288
GO:0099182	Component	Presynaptic intermediate filament cytoskeleton	IDA	18003859
GO:0140664	Function	ATP-dependent DNA damage sensor activity	IEA
GO:1904631	Process	Response to glucoside	IEA
GO:1990414	Process	Replication-born double-strand break repair via sister chromatid exchange	IEA
GO:1990426	Process	Mitotic recombination-dependent replication fork processing	IEA
GO:1990918	Process	Double-strand break repair involved in meiotic recombination	IEA
GO:2000001	Process	Regulation of DNA damage checkpoint	NAS	14636569

Other IDs

• MIM: 179617
• HGNC: 9817
• e!Ensembl: ENSG00000051180

Protein

• UniProt ID: Q06609
• Protein name: DNA repair protein RAD51 homolog 1 (HsRAD51) (hRAD51) (RAD51 homolog A)
• Protein function: Plays an important role in homologous strand exchange, a key step in DNA repair through homologous recombination (HR) (PubMed:12205100, PubMed:18417535, PubMed:20231364, PubMed:20348101, PubMed:22325354, PubMed:23509288, PubMed:23754376, PubMed:
• PDB: 1B22, 1N0W, 5H1B, 5H1C, 5JZC, 5NP7, 5NWL, 7C9A, 7EJC, 7EJE, 8BQ2, 8BR2, 8BSC, 8GYK, 8JND, 8JNE, 8JNF, 8PBC, 8PBD, 8R64, 8RCD, 8RCF, 8XBT, 8XBU, 8XBV, 8XBW, 8XBX, 8XBY
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF14520	HHH_5	31 → 80		Domain
  PF08423	Rad51	84 → 337	Rad51	Domain

• Tissue specificity: TISSUE SPECIFICITY: Highly expressed in testis and thymus, followed by small intestine, placenta, colon, pancreas and ovary. Weakly expressed in breast.
• Sequence:

  MAMQMQLEANADTSVEEESFGPQPISRLEQCGINANDVKKLEEAGFHTVEAVAYAPKKEL
  INIKGISEAKADKILAEAAKLVPMGFTTATEFHQRRSEIIQITTGSKELDKLLQGGIETG
  SITEMFGEFRTGKTQICHTLAVTCQLPIDRGGGEGKAMYIDTEGTFRPERLLAVAERYGL
  SGSDVLDNVAYARAFNTDHQTQLLYQASAMMVESRYALLIVDSATALYRTDYSGRGELSA
  RQMHLARFLRMLLRLADEFGVAVVITNQVVAQVDGAAMFAADPKKPIGGNIIAHASTTRL
  YLRKGRGETRICKIYDSPCLPEAEAMFAINADGVGDAKD

• Sequence length: 339

Pathways

KEGG:

Homologous recombination
Fanconi anemia pathway
Pathways in cancer
Pancreatic cancer

Reactome:

HDR through Single Strand Annealing (SSA)
HDR through Homologous Recombination (HRR)
Resolution of D-loop Structures through Synthesis-Dependent Strand Annealing (SDSA)
Resolution of D-loop Structures through Holliday Junction Intermediates
Homologous DNA Pairing and Strand Exchange
Presynaptic phase of homologous DNA pairing and strand exchange
Transcriptional Regulation by E2F6

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Causal
Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Familial cancer of breast	Pathogenic	rs199925463	RCV003322592	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Fanconi anemia complementation group R	Likely pathogenic; Pathogenic	rs2504532073, rs2504524090, rs1057519413, rs1555429629, rs1895530875	RCV003326675 RCV003225638 RCV000412566 RCV000626039 RCV001172541	★★★★★ ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Mirror movements 2	Pathogenic	rs199925463, rs34091239, rs1555429623	RCV000022747 RCV000022748 RCV000542570	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
RAD51-related disorder	Likely pathogenic; Pathogenic	rs2504406488, rs1057519413	RCV004536683 RCV001731668	★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
Acute myeloid leukemia	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANXIETY DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast cancer, susceptibility to, in BRCA1 and BRCA2 carriers	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Clear cell carcinoma of kidney	Conflicting classifications of pathogenicity	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FAMILIAL CONGENITAL MIRROR MOVEMENTS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FANCONI ANEMIA	—	CTD, Disgenet, Orphanet CTD, Disgenet, Orphanet CTD, Disgenet, Orphanet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FANCONI ANEMIA, COMPLEMENTATION GROUP R	—	CTD, Disgenet, HPO CTD, Disgenet, HPO CTD, Disgenet, HPO	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GENETIC PREDISPOSITION TO DISEASE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Germ cell tumor of testis	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEAD AND NECK NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEREDITARY BREAST AND/OR OVARIAN CANCER SYNDROME	—	Orphanet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEREDITARY BREAST CARCINOMA	—	GenCC	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hereditary cancer	Conflicting classifications of pathogenicity; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hereditary cancer-predisposing syndrome	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant lymphoma, large B-cell, diffuse	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MIRROR MOVEMENT DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MIRROR MOVEMENTS 1	—	CTD, ClinVar, HPO CTD, ClinVar, HPO CTD, ClinVar, HPO	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian cancer	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TRIPLE NEGATIVE BREAST NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine carcinosarcoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uveal melanoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
2-3 toe syndactyly	Syndactyly Of The Toes	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
Acute leukemia	Leukemia	BEFREE	24457040		★☆☆☆☆ Found in Text Mining only
Acute monocytic leukemia	Monocytic Leukemia	GENOMICS_ENGLAND_DG	28297620		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	LHGDN	11935313		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	28099437, 28139510		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	29290255		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of pancreas	Pancreatic adenocarcinoma	BEFREE	10851081, 11935313		★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	10583305		★☆☆☆☆ Found in Text Mining only
Adult Medulloblastoma	Medulloblastoma	BEFREE	19117011, 22439007		★☆☆☆☆ Found in Text Mining only
Adult T-Cell Lymphoma/Leukemia	T-Cell Lymphoma/Leukemia	BEFREE	28466382, 30577817, 31638261		★☆☆☆☆ Found in Text Mining only
Age related macular degeneration	Age-related macular degeneration	BEFREE	23868022		★☆☆☆☆ Found in Text Mining only
Agenesis of corpus callosum	Agenesis Of Corpus Callosum	HPO_DG			★☆☆☆☆ Found in Text Mining only
Anaplasia	Anaplasia	BEFREE	26586793		★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	Pubtator	33662100	Associate	★☆☆☆☆ Found in Text Mining only
Anemia Hemolytic	Hemolytic anemia	Pubtator	17384638, 23318456, 26681308	Associate	★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	31126889		★☆☆☆☆ Found in Text Mining only
Anorexia	Anorexia	Pubtator	33662100	Associate	★☆☆☆☆ Found in Text Mining only
Anus, Imperforate	Imperforate anus	HPO_DG			★☆☆☆☆ Found in Text Mining only
Anus, Imperforate	Imperforate anus	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	GWASCAT_DG	31116379		★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	36835215	Associate	★☆☆☆☆ Found in Text Mining only
Astigmatism	Astigmatism	HPO_DG			★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	17034947		★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia Telangiectasia	BEFREE	31748913		★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia telangiectasia	Pubtator	9315668	Associate	★☆☆☆☆ Found in Text Mining only
Atrial Septal Defects	Atrial Septal Defect	HPO_DG			★☆☆☆☆ Found in Text Mining only
Atrial Septal Defects	Atrial Septal Defect	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
Azoospermia	Azoospermia	HPO_DG			★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	28123543		★☆☆☆☆ Found in Text Mining only
B-CELL MALIGNANCY, LOW-GRADE	Lymphocytic Leukemia	BEFREE	10473103		★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	Pubtator	21423218	Stimulate	★☆☆☆☆ Found in Text Mining only
bilateral breast cancer	Breast Cancer	BEFREE	10807537		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	21740187, 30550547		★☆☆☆☆ Found in Text Mining only
Blepharoptosis	Ptosis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Blepharoptosis	Ptosis	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
Bloom Syndrome	Bloom Syndrome	BEFREE	10652259, 10767546, 7989048		★☆☆☆☆ Found in Text Mining only
Bloom Syndrome	Bloom syndrome	Pubtator	12975363, 19632996, 20215422, 21113733	Associate	★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	24060578, 29287594	Associate	★☆☆☆☆ Found in Text Mining only
Breast Cancer, Familial	Breast Cancer	BEFREE	10197592, 10807537, 12750242, 16624550, 16762046, 17063276, 17889711, 20358297, 24114315, 25409685, 26954070		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	10551859, 11248061, 11535547, 12427531, 12442171, 12606939, 12673366, 12750242, 12967658, 15138485, 15734952, 16261408, 16624550, 16762046, 17063276, 17180310, 17301259, 17351394, 17666788, 17707537, 17889711, 17999359, 18283561, 18429825, 18632222, 18974064, 19106292, 19426727, 20054644, 20092964, 20358297, 20396943, 20454923, 20461453, 20623332, 20640595, 21064098, 21283680, 21666281, 21701125, 21708019, 21725594, 21750962, 22579953, 23065228, 23071527, 23300655, 23341130, 23404160, 23798621, 23897704, 24040396, 24114315, 24240613, 24604328, 24616504, 24811120, 24948741, 25304112, 25354554, 25556451, 25566853, 25690937, 26108708, 26317153, 26650628, 26713604, 26954070, 27153211, 27464795, 27513445, 28111726, 28315507, 28471392, 28759753, 28846114, 29255180, 29635390, 30139880, 30229259, 30244171, 30377213, 30521029, 30931099, 31206626, 31492187, 31506496, 31775907, 9405383, 9594439		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	HPO_DG			★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	CTD_human_DG			★☆☆☆☆ Found in Text Mining only
Breast Diseases	Breast disease	Pubtator	25836596, 37725154	Associate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	10507777, 10551859, 11248061, 15138485, 15671039, 15937124, 16415210, 16762046, 17180310, 17666788, 17947333, 17999359, 19106292, 19671671, 20729858, 21290343, 21666281, 21701125, 21708019, 21789034, 22789542, 23300655, 23404160, 23625599, 23798621, 24060578, 24141787, 24616504, 24835992, 24884479, 25304112, 25354554, 25409685, 25539919, 25556451, 25570853, 25690937, 26317153, 26787654, 26954070, 27153211, 27513445, 27584664, 28299801, 28315507, 28667302, 29100040, 29255180, 29287594, 29463647, 30250272, 30358196, 30420728, 31311202, 31371347, 31492187, 31506496, 31905201, 32968016, 33128008, 34356606, 35061678, 35217791, 35249172, 35409110, 35425960, 35502895, 35713220, 36344674, 37725154, 38063232, 38066224, 9405383	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	23977219	Stimulate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Bronchioloalveolar Adenocarcinoma	Lung adenocarcinoma	BEFREE	21423218		★☆☆☆☆ Found in Text Mining only
Byzanthine arch palate	High palate	HPO_DG			★☆☆☆☆ Found in Text Mining only
Cafe au lait spots, multiple	Cafe-au-lait spot	HPO_DG			★☆☆☆☆ Found in Text Mining only
Cancer of Head	Neoplasm of head	CTD_human_DG	22613844		★☆☆☆☆ Found in Text Mining only
Cancer of Nasopharynx	Nasopharyngeal Cancer	BEFREE	30144445		★☆☆☆☆ Found in Text Mining only
Cancer of Neck	Neck Cancer	CTD_human_DG	22613844		★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	19336413, 21503571, 22166496, 22789542, 26317153, 27753535, 28667302, 36233194	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	18377894, 18430445, 18544565, 19157634, 20042515, 21810436, 26212550		★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	30462539, 36261080, 36271841, 37051625, 37175611	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	34115569	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	21740187		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	15785736, 18377894, 18430445, 18544565, 20042515, 20855443, 21810436, 21857991, 25640347, 27102076, 29673125, 30478150, 30638176		★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	28376831, 28667302, 33332934, 33709473	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	27170370, 32009115, 34781823, 38607586	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	28334093, 28646528, 32685473, 35332852	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	11248061, 11535547, 12504001, 16624550, 17301259, 20371688, 24005565, 24088786, 24139550, 24457040, 24599673, 24927671, 25292178, 25642963, 26406958, 26452665, 28376831, 29084914, 29255180, 9774970		★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	BEFREE	22384017		★☆☆☆☆ Found in Text Mining only
Cataract	Cataract	HPO_DG			★☆☆☆☆ Found in Text Mining only
Cerebral Palsy	Cerebral palsy	HPO_DG			★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	22634097, 28184999, 28627709, 29551903, 31190335		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	22634097, 28627709, 29551903, 31190335		★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	21987080, 25746326		★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	19117011, 22439007		★☆☆☆☆ Found in Text Mining only
Choanal Atresia	Choanal Atresia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	Pubtator	40527032	Associate	★☆☆☆☆ Found in Text Mining only
Chondrosarcoma	Chondrosarcoma	Pubtator	38442236	Associate	★☆☆☆☆ Found in Text Mining only
Chromosomal Instability	Chromosomal instability	Pubtator	21409565, 26617897, 34500463	Associate	★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	10473103, 21281966		★☆☆☆☆ Found in Text Mining only
Chronic myeloproliferative disorder	Myeloproliferative disorder	BEFREE	26979391		★☆☆☆☆ Found in Text Mining only
Cleft Palate	Cleft palate	Pubtator	23776525	Associate	★☆☆☆☆ Found in Text Mining only
Clinodactyly of the 5th finger	Camptodactyly of fingers	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
Clinodactyly of the 5th finger	Camptodactyly of fingers	HPO_DG			★☆☆☆☆ Found in Text Mining only
Cockayne Syndrome	Cockayne syndrome	Pubtator	25820262	Associate	★☆☆☆☆ Found in Text Mining only
Cockayne Syndrome	Cockayne Syndrome	BEFREE	30297739		★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	25247297	Associate	★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	21570414, 29061656		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	21104022, 24457040, 24871558, 26617897, 28099437, 29893328, 30358196, 30448264, 30477538, 31796878		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	17109495	Inhibit	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	21104022, 23161237, 25909291, 26617897, 28099437, 28173629, 28573382, 30358196, 31796878, 31973027, 32458654, 33531658, 35758246, 35881546, 35969531	Associate	★☆☆☆☆ Found in Text Mining only
Congenital arteriovenous malformation	Congenital Arteriovenous Malformation	HPO_DG			★☆☆☆☆ Found in Text Mining only
Congenital Bone Marrow Failure Syndromes	Congenital bone marrow failure syndrome	Pubtator	33104793	Associate	★☆☆☆☆ Found in Text Mining only
Congenital chromosomal disease	Congenital Chromosomal Disease	BEFREE	16778173, 17114795, 18066084, 27513445, 30773277		★☆☆☆☆ Found in Text Mining only
Congenital Epicanthus	Congenital Epicanthus	HPO_DG			★☆☆☆☆ Found in Text Mining only
Congenital exomphalos	Congenital Exomphalos	HPO_DG			★☆☆☆☆ Found in Text Mining only
Cranial nerve palsies	Cranial Nerve Paralysis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Cryptorchidism	Cryptorchidism	HPO_DG			★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	11724828		★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic fibrosis	Pubtator	11724828, 12958239	Associate	★☆☆☆☆ Found in Text Mining only
Deglutition Disorders	Dysphagia	BEFREE	21704413		★☆☆☆☆ Found in Text Mining only
Depression Postpartum	Major depressive disorder	Pubtator	34856750	Associate	★☆☆☆☆ Found in Text Mining only
Developmental Disabilities	Development Disorder	BEFREE	23754376, 28057929		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	28461573		★☆☆☆☆ Found in Text Mining only
Differentiated Thyroid Gland Carcinoma	Thyroid Carcinoma	BEFREE	24377596		★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	31804739		★☆☆☆☆ Found in Text Mining only
Dwarfism	Dwarfism	HPO_DG			★☆☆☆☆ Found in Text Mining only
Dysgenesis of the hippocampus	Dysgenesis of the hippocampus	HPO_DG			★☆☆☆☆ Found in Text Mining only
Dysmorphic features	Dysmorphic Features	CLINVAR_DG	24808016, 25813273, 26253028		★☆☆☆☆ Found in Text Mining only
Encephalopathies	Epileptic encephalopathy	BEFREE	26400718		★☆☆☆☆ Found in Text Mining only
Endometrial Carcinoma	Endometrial carcinoma	BEFREE	20602259, 22487057, 24930116		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	20602259, 22102073, 24930116	Associate	★☆☆☆☆ Found in Text Mining only
Ependymoma	Ependymoma	BEFREE	29416789		★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	28376831		★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	21858113, 24033642, 25612937, 27590853, 31114363, 31749080		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	21858113, 24033642, 25612937, 27590853, 31114363, 31749080		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	21858113, 24033642, 28178195	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	21858113, 24065387, 38258400	Associate	★☆☆☆☆ Found in Text Mining only
Exophthalmos	Proptosis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Familial congenital mirror movements	Congenital Mirror Movements	Orphanet			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Fanconi Anemia	Fanconi Anemia	BEFREE	12117768, 12118380, 15592699, 16154163, 16207587, 16679306, 16738325, 20400963, 20509860, 21750962, 22167183, 22789542, 23318456, 23657012, 24240700, 26254775, 26681308, 26771352, 27596592, 28512217, 28575658, 28729482, 29020621, 30907510, 31584931		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Fanconi Anemia	Fanconi anemia	Pubtator	16738325, 22789542, 26253028, 31584931, 32735670, 34115569, 35904444, 37924868	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Fanconi Anemia	Fanconi Anemia	ORPHANET_DG	26681308		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Fanconi anemia	Fanconi Anemia	Orphanet			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Fanconi Anemia	Fanconi Anemia	GENOMICS_ENGLAND_DG	28297620		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FANCONI ANEMIA, COMPLEMENTATION GROUP A (disorder)	Anemia	BEFREE	12118380, 15592699, 16154163, 16207587, 16738325, 20400963, 20509860, 21750962, 22167183, 22789542, 23657012, 24240700, 26254775, 26771352, 28512217, 28575658, 28729482, 29020621, 30907510, 31584931		★☆☆☆☆ Found in Text Mining only
FANCONI ANEMIA, COMPLEMENTATION GROUP D2	Fanconi Anemia	BEFREE	15661754, 27694619		★☆☆☆☆ Found in Text Mining only
FANCONI ANEMIA, COMPLEMENTATION GROUP R	Fanconi Anemia	UNIPROT_DG	26253028, 26681308		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FANCONI ANEMIA, COMPLEMENTATION GROUP R	Fanconi Anemia	BEFREE	27694619		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FANCONI ANEMIA, COMPLEMENTATION GROUP R	Fanconi Anemia	CTD_human_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FANCONI ANEMIA, COMPLEMENTATION GROUP R	Fanconi Anemia	CLINVAR_DG			★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Fibrosarcoma	Fibrosarcoma	BEFREE	11461118		★☆☆☆☆ Found in Text Mining only
FRIEDREICH ATAXIA 1	Friedreich Ataxia	BEFREE	28575658		★☆☆☆☆ Found in Text Mining only
Frontal bossing	Frontal bossing	HPO_DG			★☆☆☆☆ Found in Text Mining only
Frontotemporal Dementia	Frontotemporal dementia	Pubtator	29024630	Stimulate	★☆☆☆☆ Found in Text Mining only
Fuchs Endothelial Dystrophy	Fuchs Endothelial Dystrophy	BEFREE	24223453		★☆☆☆☆ Found in Text Mining only
Fuchs' Endothelial Dystrophy	Fuchs endothelial dystrophy	Pubtator	24223453	Associate	★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	BEFREE	23178951, 29206199, 29697413		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Stromal Tumors	Gastrointestinal stromal tumor	Pubtator	29206199, 31948066	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	21363882, 22977194, 27495836, 28852018, 29574252, 30282933, 30872624	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	22977194, 25275596, 26511493, 28076755, 28376211, 28852018, 30282933, 30872624, 31504251		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	21363882, 22977194, 25275596, 26511493, 28076755, 28376211, 28852018, 30282933, 30872624, 31504251		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	14612536, 21363882, 21926087, 28076755		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	17704360, 21363882, 22073281, 25275596, 35414100	Associate	★☆☆☆☆ Found in Text Mining only
Global developmental delay	Developmental Delay	HPO_DG			★☆☆☆☆ Found in Text Mining only
Global developmental delay	Developmental Delay	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	16596227, 20804747, 21704413, 22613844, 24475258, 25556492		★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head And Neck Neoplasms	LHGDN	16596227		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Head and Neck Neoplasms	Head And Neck Neoplasms	CTD_human_DG	22613844		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	25556492	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Head Neoplasms	Head Neoplasms	CTD_human_DG	22613844		★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary Breast And Ovarian Cancer Syndrome	ORPHANET_DG	10807537, 24114315		★☆☆☆☆ Found in Text Mining only
Hereditary breast and ovarian cancer syndrome	Hereditary Breast And Ovarian Cancer Syndrome	Orphanet			★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	11248061, 19628690, 24088786, 24315737, 25304112, 29255180	Associate	★☆☆☆☆ Found in Text Mining only
Hereditary Malignant Neoplasm	Hereditary cancer	BEFREE	30836272		★☆☆☆☆ Found in Text Mining only
Hirschsprung Disease	Hirschsprung Disease	HPO_DG			★☆☆☆☆ Found in Text Mining only
Hydrocephalus	Hydrocephalus	HPO_DG			★☆☆☆☆ Found in Text Mining only
Hypertrophic Cardiomyopathy	Hypertrophic cardiomyopathy	HPO_DG			★☆☆☆☆ Found in Text Mining only
Hypogonadism	Hypogonadism	HPO_DG			★☆☆☆☆ Found in Text Mining only
Hypogonadotropic hypogonadism	Hypogonadotropic Hypogonadism	HPO_DG			★☆☆☆☆ Found in Text Mining only
Hypospadias	Hypospadias	HPO_DG			★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	15367671, 21670155, 21722982, 25611387	Inhibit	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	24627085, 24688021	Associate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	33288855	Stimulate	★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	29789556		★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Idiopathic pulmonary fibrosis	Pubtator	29789556	Associate	★☆☆☆☆ Found in Text Mining only
IMMUNODEFICIENCY 13	Immunodeficiency	BEFREE	29020621		★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Intellectual developmental disorder	Pubtator	26681308	Associate	★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Mental retardation	HPO_DG			★☆☆☆☆ Found in Text Mining only
Intrahepatic Cholangiocarcinoma	Intrahepatic Cholangiocarcinoma	BEFREE	18316552		★☆☆☆☆ Found in Text Mining only
Invasive Ductal Breast Carcinoma	Invasive Duct and Lobular Carcinoma	BEFREE	11093813		★☆☆☆☆ Found in Text Mining only
Keratoconus	Keratoconus	BEFREE	24223453		★☆☆☆☆ Found in Text Mining only
Keratoconus	Keratoconus	Pubtator	24223453	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Neoplasm	Kidney Neoplasm	BEFREE	27153211		★☆☆☆☆ Found in Text Mining only
Kidney Neoplasms	Kidney neoplasm	Pubtator	27153211	Associate	★☆☆☆☆ Found in Text Mining only
Leiomyoma	Leiomyoma	Pubtator	26888970, 30478352	Associate	★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	12024032, 21653319, 23978154		★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	LHGDN	15750625		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	31638261, 34665271	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	28030834, 34789078	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Promyelocytic Acute	Promyelocytic leukemia	Pubtator	34789078	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	15102670, 16890287, 17066094, 17761709, 21296419, 21725251, 23978154, 24040396, 24367670, 26858310, 27173193		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	GENOMICS_ENGLAND_DG	28297620		★☆☆☆☆ Found in Text Mining only
Leukemia, T-Cell	T-cell leukemia	BEFREE	31638261		★☆☆☆☆ Found in Text Mining only
Leukopenia	Leukopenia	HPO_DG			★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	20509860, 21915862, 26752698, 28646552, 30462539		★☆☆☆☆ Found in Text Mining only
Long narrow head	Dolichocephaly	HPO_DG			★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	LHGDN	18544565		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	25640347, 27102076, 29108454, 29673125, 30638176, 31865638, 34648881, 38296976	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	23404160, 24065387, 28139510, 34978208, 35249172	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	23977219, 28099437, 38063232	Stimulate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	12024032		★☆☆☆☆ Found in Text Mining only
Lymphoma Follicular	Lymphoma	Pubtator	22102710	Associate	★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	16596227, 20804747, 21704413, 22613844, 24475258, 25556492		★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	CTD_human_DG	22613844		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	10551859, 11093813, 11248061, 11535547, 12427531, 12442171, 12606939, 12673366, 12750242, 12967658, 15138485, 15734952, 16261408, 16624550, 16762046, 17063276, 17180310, 17301259, 17351394, 17666788, 17707537, 17889711, 17999359, 18283561, 18429825, 18632222, 18752184, 18974064, 19106292, 19426727, 20054644, 20092964, 20358297, 20396943, 20454923, 20461453, 20623332, 20640595, 21064098, 21283680, 21666281, 21701125, 21708019, 21725594, 21750962, 23065228, 23071527, 23300655, 23341130, 23404160, 23798621, 23897704, 24040396, 24114315, 24604328, 24616504, 24811120, 24948741, 25304112, 25354554, 25556451, 25566853, 25690937, 26108708, 26317153, 26650628, 26713604, 26954070, 27153211, 27464795, 28111726, 28299801, 28315507, 28471392, 28759753, 29255180, 29635390, 30139880, 30229259, 30244171, 30377213, 30521029, 30554948, 30931099, 31206626, 31492187, 31506496, 31775907, 9405383, 9594439, 9765620		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	UNIPROT_DG	10807537, 25539919		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	CTD_human_DG			★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of endometrium	Endometrial Cancer	BEFREE	20602259, 24930116		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	21858113, 24033642, 25612937, 27590853, 31114363, 31749080		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	15785736, 18377894, 18430445, 18544565, 20042515, 20855443, 21810436, 21857991, 25640347, 27102076, 29673125, 30478150, 30638176		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of nasopharynx	Nasopharyngeal carcinoma	BEFREE	30144445		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	11248061, 11535547, 12504001, 16624550, 17301259, 22167183, 24005565, 24088786, 24139550, 24457040, 24599673, 24927671, 25292178, 26406958, 26452665, 27614696, 29084914, 29255180, 30551670, 9774970		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	10851081, 11935313, 23657012, 30483758		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	19914098, 20002770, 22114138, 24627085, 25127709, 26339569, 26433958, 29483142, 29500400		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	HPO_DG			★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	16843501, 25110436, 26119522		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	19772428, 28502582		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	21740187		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	10362364, 10362365, 11170890, 11248061, 11535547, 12442171, 12967658, 14599770, 15150571, 15723711, 15800615, 16475125, 16596227, 16762046, 16902145, 17118968, 17301259, 18974064, 19106292, 20097625, 20400964, 20940401, 21810436, 21858113, 22008909, 22045204, 22467216, 22487057, 22634097, 23071527, 23341130, 23754376, 24040396, 24457040, 24475258, 24753542, 24781030, 24811120, 24835992, 24859942, 25467108, 25539919, 25556492, 25743260, 26433958, 26486089, 26681308, 26850462, 26858310, 27630154, 28034904, 28099437, 28477336, 28502582, 28545975, 28627709, 29036688, 29100040, 29458757, 29681946, 29952992, 30229259, 30257212, 30551670, 31190335, 31206626, 31562898, 31632548, 31665741, 9765620		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	22634097, 28627709, 29551903, 31190335		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	21570414, 29061656		★☆☆☆☆ Found in Text Mining only
Mammary Carcinoma, Human	Marfan Syndrome	CTD_human_DG			★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	10362364, 16762046, 17942895, 25539919, 29100040, 30552643, 31492187		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	16261408, 16837909, 17180310, 17616806, 17666788, 17889711, 17999359, 18429825, 18632222, 18974064		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	CTD_human_DG			★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms, Human	Mammary Neoplasms	CTD_human_DG			★☆☆☆☆ Found in Text Mining only
Mantle cell lymphoma	Mantle Cell Lymphoma	BEFREE	16920159		★☆☆☆☆ Found in Text Mining only
Meckel Diverticulum	Meckel Diverticulum	HPO_DG			★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	19117011, 22439007		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	Pubtator	22439007	Associate	★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	26980768		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	29254481, 38070141	Associate	★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	HPO_DG			★☆☆☆☆ Found in Text Mining only
Microcephaly	Microcephaly	Pubtator	26681308, 32735676	Associate	★☆☆☆☆ Found in Text Mining only
Microcephaly	Microcephaly	BEFREE	30907510		★☆☆☆☆ Found in Text Mining only
Microcephaly	Microcephaly	HPO_DG			★☆☆☆☆ Found in Text Mining only
Micrognathism	Micrognathism	HPO_DG			★☆☆☆☆ Found in Text Mining only
Microphthalmia syndromic 7	Microphthalmia	Pubtator	32601218	Associate	★☆☆☆☆ Found in Text Mining only
Microphthalmos	Microphthalmos	HPO_DG			★☆☆☆☆ Found in Text Mining only
Mild Mental Retardation	Mental retardation	HPO_DG			★☆☆☆☆ Found in Text Mining only
Miller Dieker syndrome	Miller Dieker Syndrome	GENOMICS_ENGLAND_DG	28297620		★☆☆☆☆ Found in Text Mining only
MIRROR MOVEMENTS 2	Mirror Movements	GENOMICS_ENGLAND_DG	21242494		★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
MIRROR MOVEMENTS 2	Mirror Movements	CLINVAR_DG	21242494		★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
MIRROR MOVEMENTS 2	Mirror Movements	CTD_human_DG			★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Mirror movements disorder	Mirror Movements	BEFREE	22305526, 24056534, 25098561, 25813273, 26681308, 28117402, 30406765		★☆☆☆☆ Found in Text Mining only
Mirror movements disorder	Mirror Movements	HPO_DG			★☆☆☆☆ Found in Text Mining only
Mosaic variegated aneuploidy syndrome	Mosaic variegated aneuploidy	Pubtator	31114910	Associate	★☆☆☆☆ Found in Text Mining only
Movement Disorders	Movement Disorders	BEFREE	25210500		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	12969976, 22729783, 25790254, 32060401	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	22729783, 25996477		★☆☆☆☆ Found in Text Mining only
Myelodysplasia	Myelodysplasia	HPO_DG			★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	21176850, 23955800, 25312513, 26339619, 26482462, 28681469		★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	GENOMICS_ENGLAND_DG	28297620		★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	HPO_DG			★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	27497341	Associate	★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia, Chronic	Myeloid Leukemia	BEFREE	23341130		★☆☆☆☆ Found in Text Mining only
Myopia	Myopia	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	22797071, 25175062, 30144445		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	28557284, 33397362, 39664566	Associate	★☆☆☆☆ Found in Text Mining only
Nausea	Nausea	Pubtator	33662100	Associate	★☆☆☆☆ Found in Text Mining only
Neck Neoplasms	Neck Neoplasms	CTD_human_DG	22613844		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	10362365, 10493508, 10583305, 11266555, 11343905, 11759816, 11935313, 12606939, 12712436, 14599770, 14633686, 14645207, 15367671, 15942943, 16234517, 16596227, 16847424, 17495946, 17707537, 18003859, 18066084, 19106292, 19942681, 20625943, 20871616, 21064098, 21363882, 21926087, 22008909, 22045204, 22384017, 22579953, 22634097, 22790088, 22833573, 23200172, 23657012, 24618637, 24722796, 24753542, 24930116, 25354554, 25539919, 25765654, 26145171, 27037238, 27513445, 27584664, 27630154, 27694622, 28034904, 28099437, 28236982, 28502582, 28627709, 28968952, 29180466, 29458771, 29483142, 29635390, 29955143, 30289394, 30477538, 30552643, 30917004, 31029033, 31344491, 31492187, 31749080		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	31632548		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	33277872, 37020276	Associate	★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	15785736, 19671683, 19799875, 19960343, 20042515, 20855443, 21810436, 22799356, 23069143, 23399959, 23570471, 24722796, 25640347, 28236982, 29290255, 29673125, 31114249		★☆☆☆☆ Found in Text Mining only
Nystagmus	Nystagmus	HPO_DG			★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	29459183	Associate	★☆☆☆☆ Found in Text Mining only
Oestrogen receptor positive breast cancer	Oestrogen Receptor Positive Breast Cancer	BEFREE	31506496		★☆☆☆☆ Found in Text Mining only
Oral Mucositis	Oral Mucositis	BEFREE	28623401		★☆☆☆☆ Found in Text Mining only
Orofacial Cleft 1	Orofacial cleft	Pubtator	23776525	Associate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	27802335	Inhibit	★☆☆☆☆ Found in Text Mining only
Osteoarthritis of hip	Osteoarthritis Of Hip	BEFREE	27802335		★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	36795607	Inhibit	★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	20625943, 24088786, 30006631		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	24088786, 32033398, 36717782	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Carcinoma	Ovarian Carcinoma	BEFREE	26406958		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	11248061, 11535547, 12504001, 16624550, 17301259, 24005565, 24088786, 24139550, 24457040, 24599673, 24927671, 25292178, 26452665, 29084914, 29255180, 9774970		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	HPO_DG			★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	11170890, 24005565, 24375044, 26261251, 26406958, 26452665, 28139510, 29255180, 30712190, 32554304, 33709473, 33779077, 34732853, 34837690, 35425960, 36099300, 36807748, 37344587, 37504067, 37541687, 37973845, 39863011	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Serous Adenocarcinoma	Ovarian serous adenocarcinoma	BEFREE	28139510		★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	10851081, 11935313, 23657012, 30483758		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	HPO_DG			★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	11935313, 19139112, 25558828, 38194775	Associate	★☆☆☆☆ Found in Text Mining only
Pancytopenia	Pancytopenia	BEFREE	28512217, 30907510		★☆☆☆☆ Found in Text Mining only
Papilloma	Papilloma	BEFREE	30648820		★☆☆☆☆ Found in Text Mining only
Parathyroid Adenoma	Parathyroid Adenoma	BEFREE	10583305		★☆☆☆☆ Found in Text Mining only
Parathyroid Neoplasms	Parathyroid Neoplasms	BEFREE	10583305		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	28117402		★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	28117402	Associate	★☆☆☆☆ Found in Text Mining only
Patent ductus arteriosus	Patent ductus arteriosus	HPO_DG			★☆☆☆☆ Found in Text Mining only
Port-Wine Stain	Phakomatosis pigmentovascularis	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
Premature aging syndrome	Premature aging	BEFREE	20097625		★☆☆☆☆ Found in Text Mining only
Primary peritoneal carcinoma	Peritoneal Carcinoma	HPO_DG			★☆☆☆☆ Found in Text Mining only
Progeria	Progeria	BEFREE	17848622		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	19914098, 22114138, 24627085, 25127709, 26339569, 26433958, 29483142, 29500400, 31831298		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	11266555, 20002770, 24627085, 25127709, 26339569, 36650183	Associate	★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	22114138		★☆☆☆☆ Found in Text Mining only
Pterygium	Pterygium	BEFREE	21077755		★☆☆☆☆ Found in Text Mining only
Ptosis	Ptosis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Radial polydactyly	Radial Polydactyly	CLINVAR_DG			★☆☆☆☆ Found in Text Mining only
Rectal Carcinoma	Rectal Carcinoma	BEFREE	30289394		★☆☆☆☆ Found in Text Mining only
Renal Insufficiency	Renal Insufficiency	HPO_DG			★☆☆☆☆ Found in Text Mining only
Retinoblastoma	Retinoblastoma	BEFREE	28320735		★☆☆☆☆ Found in Text Mining only
Rickets Hypophosphatemic	Hypophosphatemic rickets	Pubtator	21149701	Associate	★☆☆☆☆ Found in Text Mining only
Rufous oculocutaneous albinism	Rufous oculocutaneous albinism	Pubtator	28139510	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	LHGDN	17513613		★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	21501635		★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	Pubtator	21508354, 36779660	Associate	★☆☆☆☆ Found in Text Mining only
Sarcoma Ewing	Sarcoma	Pubtator	36042341	Stimulate	★☆☆☆☆ Found in Text Mining only
Sarcoma Synovial	Synovial sarcoma	Pubtator	27353471	Associate	★☆☆☆☆ Found in Text Mining only
Scoliosis, unspecified	Scoliosis	HPO_DG			★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	12712436		★☆☆☆☆ Found in Text Mining only
Small Lymphocytic Lymphoma	Lymphocytic Leukemia	BEFREE	16920159		★☆☆☆☆ Found in Text Mining only
Specific learning disability	Specific Learning Disorder	HPO_DG			★☆☆☆☆ Found in Text Mining only
Spina Bifida	Spina Bifida	HPO_DG			★☆☆☆☆ Found in Text Mining only
Sporadic Breast Carcinoma	Breast Carcinoma	BEFREE	17063276, 21708019, 26650628, 28058614		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	30033552		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	24568492, 31749080		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	24315737, 26505394, 27584664, 31391008, 32190537	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of oropharynx	Oropharyngeal carcinoma	BEFREE	28646528		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	17118968, 18768166, 19841536, 20804747, 21704413, 24457040, 26505394, 27584664		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	16843501, 25110436, 26119522		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	32902196, 34978208, 35902562, 37129948	Associate	★☆☆☆☆ Found in Text Mining only
Stomatitis	Stomatitis	BEFREE	28623401		★☆☆☆☆ Found in Text Mining only
Strabismus	Strabismus	HPO_DG			★☆☆☆☆ Found in Text Mining only
Syndactyly of fingers	Syndactyly of fingers	HPO_DG			★☆☆☆☆ Found in Text Mining only
Syndactyly of the toes	Syndactyly Of The Toes	HPO_DG			★☆☆☆☆ Found in Text Mining only
Tetralogy of Fallot	Tetralogy of Fallot	HPO_DG			★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	19772428, 28502582, 30319685		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	19772428, 28502582		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	24377596, 37864896	Associate	★☆☆☆☆ Found in Text Mining only
Trichohepatoenteric Syndrome	Trichohepatoenteric Syndrome	BEFREE	7989048		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	23625599, 24773628, 25743260, 30478172, 31235595, 31492187, 31541611, 32294924, 34036395, 34520831, 37081516, 40300663	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	24616504, 24773628, 24811120, 25743260, 28034904, 28545975, 30259975, 30478172, 30736840, 31029033, 31235595, 31492187, 31640742		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ulcerative Colitis	Ulcerative colitis	BEFREE	25247297		★☆☆☆☆ Found in Text Mining only
Upper Aerodigestive Tract Neoplasms	Upper Aerodigestive Tract Neoplasms	CTD_human_DG	22613844		★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	21740187, 40083696	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	19106292, 22634097, 24708616, 28627709, 34319032, 35996502	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	34151839	Stimulate	★☆☆☆☆ Found in Text Mining only
Uterine Fibroids	Uterine Fibroids	BEFREE	30478352		★☆☆☆☆ Found in Text Mining only
Uveal melanoma	Uveal Melanoma	BEFREE	23318456		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Werner Syndrome	Werner Syndrome	BEFREE	11380620, 11514625, 12242278, 28640365		★☆☆☆☆ Found in Text Mining only
Werner Syndrome	Werner syndrome	Pubtator	11514625, 12242278	Associate	★☆☆☆☆ Found in Text Mining only
Xeroderma Pigmentosum Complementation Group D	Xeroderma pigmentosum	Pubtator	21740187	Associate	★☆☆☆☆ Found in Text Mining only
Xeroderma Pigmentosum, Complementation Group D	Xeroderma Pigmentosum	BEFREE	21740187		★☆☆☆☆ Found in Text Mining only