Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Transcription factors Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	5883
Gene name	RAD9 checkpoint clamp component A
Gene symbol	RAD9A
Synonyms (NCBI Gene)	RAD9
Chromosome	11
Chromosome location	11q13.2
Summary	This gene product is highly similar to Schizosaccharomyces pombe rad9, a cell cycle checkpoint protein required for cell cycle arrest and DNA damage repair. This protein possesses 3` to 5` exonuclease activity, which may contribute to its role in sensing

258

Show/Hide all (258)

miRTarBase ID	miRNA	Experiments	Reference
MIRT026047	hsa-miR-196a-5p	Sequencing	20371350
MIRT032159	hsa-let-7d-5p	Sequencing	20371350
MIRT1288244	hsa-let-7a	CLIP-seq
MIRT1288245	hsa-let-7b	CLIP-seq
MIRT1288246	hsa-let-7c	CLIP-seq
MIRT1288247	hsa-let-7d	CLIP-seq
MIRT1288248	hsa-let-7e	CLIP-seq
MIRT1288249	hsa-let-7f	CLIP-seq
MIRT1288250	hsa-let-7g	CLIP-seq
MIRT1288251	hsa-let-7i	CLIP-seq
MIRT1288252	hsa-miR-1207-3p	CLIP-seq
MIRT1288253	hsa-miR-1226	CLIP-seq
MIRT1288254	hsa-miR-1244	CLIP-seq
MIRT1288255	hsa-miR-1287	CLIP-seq
MIRT1288256	hsa-miR-1299	CLIP-seq
MIRT1288257	hsa-miR-15a	CLIP-seq
MIRT1288258	hsa-miR-15b	CLIP-seq
MIRT1288259	hsa-miR-16	CLIP-seq
MIRT1288260	hsa-miR-1915	CLIP-seq
MIRT1288261	hsa-miR-195	CLIP-seq
MIRT1288262	hsa-miR-199a-3p	CLIP-seq
MIRT1288263	hsa-miR-199b-3p	CLIP-seq
MIRT1288264	hsa-miR-2115	CLIP-seq
MIRT1288265	hsa-miR-2467-5p	CLIP-seq
MIRT1288266	hsa-miR-3074-5p	CLIP-seq
MIRT1288267	hsa-miR-3127-5p	CLIP-seq
MIRT1288268	hsa-miR-3129-5p	CLIP-seq
MIRT1288269	hsa-miR-3130-3p	CLIP-seq
MIRT1288270	hsa-miR-3135b	CLIP-seq
MIRT1288271	hsa-miR-3150a-3p	CLIP-seq
MIRT1288272	hsa-miR-3151	CLIP-seq
MIRT1288273	hsa-miR-3175	CLIP-seq
MIRT1288274	hsa-miR-3188	CLIP-seq
MIRT1288275	hsa-miR-320e	CLIP-seq
MIRT1288276	hsa-miR-337-5p	CLIP-seq
MIRT1288277	hsa-miR-342-3p	CLIP-seq
MIRT1288278	hsa-miR-361-3p	CLIP-seq
MIRT1288279	hsa-miR-3651	CLIP-seq
MIRT1288280	hsa-miR-3652	CLIP-seq
MIRT1288281	hsa-miR-3691-3p	CLIP-seq
MIRT1288282	hsa-miR-3914	CLIP-seq
MIRT1288283	hsa-miR-3918	CLIP-seq
MIRT1288284	hsa-miR-3919	CLIP-seq
MIRT1288285	hsa-miR-3975	CLIP-seq
MIRT1288286	hsa-miR-3978	CLIP-seq
MIRT1288287	hsa-miR-424	CLIP-seq
MIRT1288288	hsa-miR-4265	CLIP-seq
MIRT1288289	hsa-miR-4293	CLIP-seq
MIRT1288290	hsa-miR-4296	CLIP-seq
MIRT1288291	hsa-miR-4320	CLIP-seq
MIRT1288292	hsa-miR-4322	CLIP-seq
MIRT1288293	hsa-miR-433	CLIP-seq
MIRT1288294	hsa-miR-4430	CLIP-seq
MIRT1288295	hsa-miR-4435	CLIP-seq
MIRT1288296	hsa-miR-4446-3p	CLIP-seq
MIRT1288297	hsa-miR-4447	CLIP-seq
MIRT1288298	hsa-miR-4458	CLIP-seq
MIRT1288299	hsa-miR-4472	CLIP-seq
MIRT1288300	hsa-miR-4480	CLIP-seq
MIRT1288301	hsa-miR-4485	CLIP-seq
MIRT1288302	hsa-miR-4500	CLIP-seq
MIRT1288303	hsa-miR-4505	CLIP-seq
MIRT1288304	hsa-miR-4524	CLIP-seq
MIRT1288305	hsa-miR-4640-5p	CLIP-seq
MIRT1288306	hsa-miR-4649-3p	CLIP-seq
MIRT1288307	hsa-miR-4685-5p	CLIP-seq
MIRT1288308	hsa-miR-4722-3p	CLIP-seq
MIRT1288309	hsa-miR-4726-5p	CLIP-seq
MIRT1288310	hsa-miR-4731-5p	CLIP-seq
MIRT1288311	hsa-miR-4733-3p	CLIP-seq
MIRT1288312	hsa-miR-4746-3p	CLIP-seq
MIRT1288313	hsa-miR-4757-5p	CLIP-seq
MIRT1288314	hsa-miR-4763-5p	CLIP-seq
MIRT1288315	hsa-miR-485-5p	CLIP-seq
MIRT1288316	hsa-miR-491-5p	CLIP-seq
MIRT1288317	hsa-miR-497	CLIP-seq
MIRT1288318	hsa-miR-503	CLIP-seq
MIRT1288319	hsa-miR-509-3p	CLIP-seq
MIRT1288320	hsa-miR-516a-3p	CLIP-seq
MIRT1288321	hsa-miR-539	CLIP-seq
MIRT1288322	hsa-miR-544b	CLIP-seq
MIRT1288323	hsa-miR-596	CLIP-seq
MIRT1288324	hsa-miR-637	CLIP-seq
MIRT1288325	hsa-miR-646	CLIP-seq
MIRT1288326	hsa-miR-647	CLIP-seq
MIRT1288327	hsa-miR-875-3p	CLIP-seq
MIRT1288328	hsa-miR-936	CLIP-seq
MIRT1288329	hsa-miR-939	CLIP-seq
MIRT1288330	hsa-miR-98	CLIP-seq
MIRT1288252	hsa-miR-1207-3p	CLIP-seq
MIRT1288254	hsa-miR-1244	CLIP-seq
MIRT2085344	hsa-miR-1252	CLIP-seq
MIRT2085345	hsa-miR-1254	CLIP-seq
MIRT1288256	hsa-miR-1299	CLIP-seq
MIRT2085346	hsa-miR-1307	CLIP-seq
MIRT1288257	hsa-miR-15a	CLIP-seq
MIRT1288258	hsa-miR-15b	CLIP-seq
MIRT1288259	hsa-miR-16	CLIP-seq
MIRT1288260	hsa-miR-1915	CLIP-seq
MIRT1288261	hsa-miR-195	CLIP-seq
MIRT1288262	hsa-miR-199a-3p	CLIP-seq
MIRT1288263	hsa-miR-199b-3p	CLIP-seq
MIRT1288265	hsa-miR-2467-5p	CLIP-seq
MIRT2085347	hsa-miR-296-5p	CLIP-seq
MIRT2085348	hsa-miR-3116	CLIP-seq
MIRT2085349	hsa-miR-3126-5p	CLIP-seq
MIRT1288267	hsa-miR-3127-5p	CLIP-seq
MIRT1288268	hsa-miR-3129-5p	CLIP-seq
MIRT1288269	hsa-miR-3130-3p	CLIP-seq
MIRT1288270	hsa-miR-3135b	CLIP-seq
MIRT2085350	hsa-miR-3180-5p	CLIP-seq
MIRT2085351	hsa-miR-3182	CLIP-seq
MIRT2085352	hsa-miR-3187-3p	CLIP-seq
MIRT1288274	hsa-miR-3188	CLIP-seq
MIRT1288277	hsa-miR-342-3p	CLIP-seq
MIRT1288279	hsa-miR-3651	CLIP-seq
MIRT1288280	hsa-miR-3652	CLIP-seq
MIRT2085353	hsa-miR-3689a-3p	CLIP-seq
MIRT2085354	hsa-miR-3689c	CLIP-seq
MIRT1288281	hsa-miR-3691-3p	CLIP-seq
MIRT1288283	hsa-miR-3918	CLIP-seq
MIRT1288285	hsa-miR-3975	CLIP-seq
MIRT1288286	hsa-miR-3978	CLIP-seq
MIRT1288287	hsa-miR-424	CLIP-seq
MIRT2085355	hsa-miR-4252	CLIP-seq
MIRT2085356	hsa-miR-4277	CLIP-seq
MIRT1288289	hsa-miR-4293	CLIP-seq
MIRT2085357	hsa-miR-4294	CLIP-seq
MIRT2085358	hsa-miR-4419a	CLIP-seq
MIRT1288294	hsa-miR-4430	CLIP-seq
MIRT1288295	hsa-miR-4435	CLIP-seq
MIRT2085359	hsa-miR-4476	CLIP-seq
MIRT1288300	hsa-miR-4480	CLIP-seq
MIRT1288303	hsa-miR-4505	CLIP-seq
MIRT2085360	hsa-miR-4510	CLIP-seq
MIRT2085361	hsa-miR-4533	CLIP-seq
MIRT2085362	hsa-miR-4638-5p	CLIP-seq
MIRT1288306	hsa-miR-4649-3p	CLIP-seq
MIRT2085363	hsa-miR-4660	CLIP-seq
MIRT1288307	hsa-miR-4685-5p	CLIP-seq
MIRT2085364	hsa-miR-4701-5p	CLIP-seq
MIRT2085365	hsa-miR-4727-5p	CLIP-seq
MIRT1288310	hsa-miR-4731-5p	CLIP-seq
MIRT1288313	hsa-miR-4757-5p	CLIP-seq
MIRT2085366	hsa-miR-4769-3p	CLIP-seq
MIRT2085367	hsa-miR-4792	CLIP-seq
MIRT2085368	hsa-miR-4793-3p	CLIP-seq
MIRT1288315	hsa-miR-485-5p	CLIP-seq
MIRT1288317	hsa-miR-497	CLIP-seq
MIRT2085369	hsa-miR-544	CLIP-seq
MIRT1288322	hsa-miR-544b	CLIP-seq
MIRT2085370	hsa-miR-548s	CLIP-seq
MIRT2085371	hsa-miR-588	CLIP-seq
MIRT1288323	hsa-miR-596	CLIP-seq
MIRT2085372	hsa-miR-603	CLIP-seq
MIRT2085373	hsa-miR-661	CLIP-seq
MIRT2085374	hsa-miR-873	CLIP-seq
MIRT1288327	hsa-miR-875-3p	CLIP-seq
MIRT2085375	hsa-miR-885-3p	CLIP-seq
MIRT2085376	hsa-miR-892b	CLIP-seq
MIRT1288328	hsa-miR-936	CLIP-seq
MIRT1288244	hsa-let-7a	CLIP-seq
MIRT1288245	hsa-let-7b	CLIP-seq
MIRT1288246	hsa-let-7c	CLIP-seq
MIRT1288247	hsa-let-7d	CLIP-seq
MIRT1288248	hsa-let-7e	CLIP-seq
MIRT1288249	hsa-let-7f	CLIP-seq
MIRT1288250	hsa-let-7g	CLIP-seq
MIRT1288251	hsa-let-7i	CLIP-seq
MIRT1288252	hsa-miR-1207-3p	CLIP-seq
MIRT1288253	hsa-miR-1226	CLIP-seq
MIRT1288254	hsa-miR-1244	CLIP-seq
MIRT2085344	hsa-miR-1252	CLIP-seq
MIRT2085345	hsa-miR-1254	CLIP-seq
MIRT1288255	hsa-miR-1287	CLIP-seq
MIRT1288257	hsa-miR-15a	CLIP-seq
MIRT1288258	hsa-miR-15b	CLIP-seq
MIRT1288259	hsa-miR-16	CLIP-seq
MIRT2310773	hsa-miR-1827	CLIP-seq
MIRT1288260	hsa-miR-1915	CLIP-seq
MIRT1288261	hsa-miR-195	CLIP-seq
MIRT1288262	hsa-miR-199a-3p	CLIP-seq
MIRT1288263	hsa-miR-199b-3p	CLIP-seq
MIRT2310774	hsa-miR-2277-3p	CLIP-seq
MIRT1288265	hsa-miR-2467-5p	CLIP-seq
MIRT2310775	hsa-miR-2682	CLIP-seq
MIRT2310776	hsa-miR-2861	CLIP-seq
MIRT2085347	hsa-miR-296-5p	CLIP-seq
MIRT2085348	hsa-miR-3116	CLIP-seq
MIRT1288267	hsa-miR-3127-5p	CLIP-seq
MIRT1288268	hsa-miR-3129-5p	CLIP-seq
MIRT1288270	hsa-miR-3135b	CLIP-seq
MIRT1288274	hsa-miR-3188	CLIP-seq
MIRT1288275	hsa-miR-320e	CLIP-seq
MIRT1288277	hsa-miR-342-3p	CLIP-seq
MIRT2310777	hsa-miR-34a	CLIP-seq
MIRT2310778	hsa-miR-34c-5p	CLIP-seq
MIRT2310779	hsa-miR-3617	CLIP-seq
MIRT1288279	hsa-miR-3651	CLIP-seq
MIRT1288280	hsa-miR-3652	CLIP-seq
MIRT1288281	hsa-miR-3691-3p	CLIP-seq
MIRT1288282	hsa-miR-3914	CLIP-seq
MIRT1288283	hsa-miR-3918	CLIP-seq
MIRT2310780	hsa-miR-3974	CLIP-seq
MIRT1288285	hsa-miR-3975	CLIP-seq
MIRT1288287	hsa-miR-424	CLIP-seq
MIRT1288289	hsa-miR-4293	CLIP-seq
MIRT1288293	hsa-miR-433	CLIP-seq
MIRT1288294	hsa-miR-4430	CLIP-seq
MIRT1288298	hsa-miR-4458	CLIP-seq
MIRT2085359	hsa-miR-4476	CLIP-seq
MIRT1288300	hsa-miR-4480	CLIP-seq
MIRT2310781	hsa-miR-449a	CLIP-seq
MIRT2310782	hsa-miR-449b	CLIP-seq
MIRT2310783	hsa-miR-449c	CLIP-seq
MIRT1288302	hsa-miR-4500	CLIP-seq
MIRT1288303	hsa-miR-4505	CLIP-seq
MIRT2085361	hsa-miR-4533	CLIP-seq
MIRT1288306	hsa-miR-4649-3p	CLIP-seq
MIRT1288307	hsa-miR-4685-5p	CLIP-seq
MIRT1288310	hsa-miR-4731-5p	CLIP-seq
MIRT1288311	hsa-miR-4733-3p	CLIP-seq
MIRT2310784	hsa-miR-4787-5p	CLIP-seq
MIRT1288315	hsa-miR-485-5p	CLIP-seq
MIRT1288317	hsa-miR-497	CLIP-seq
MIRT1288321	hsa-miR-539	CLIP-seq
MIRT2310785	hsa-miR-542-3p	CLIP-seq
MIRT1288322	hsa-miR-544b	CLIP-seq
MIRT2310786	hsa-miR-548m	CLIP-seq
MIRT2310787	hsa-miR-582-5p	CLIP-seq
MIRT1288323	hsa-miR-596	CLIP-seq
MIRT2085372	hsa-miR-603	CLIP-seq
MIRT2310788	hsa-miR-615-5p	CLIP-seq
MIRT2310789	hsa-miR-641	CLIP-seq
MIRT2085373	hsa-miR-661	CLIP-seq
MIRT2310790	hsa-miR-766	CLIP-seq
MIRT2085374	hsa-miR-873	CLIP-seq
MIRT2085375	hsa-miR-885-3p	CLIP-seq
MIRT1288328	hsa-miR-936	CLIP-seq
MIRT1288330	hsa-miR-98	CLIP-seq
MIRT1288254	hsa-miR-1244	CLIP-seq
MIRT1288260	hsa-miR-1915	CLIP-seq
MIRT1288262	hsa-miR-199a-3p	CLIP-seq
MIRT1288263	hsa-miR-199b-3p	CLIP-seq
MIRT1288267	hsa-miR-3127-5p	CLIP-seq
MIRT1288268	hsa-miR-3129-5p	CLIP-seq
MIRT1288281	hsa-miR-3691-3p	CLIP-seq
MIRT1288283	hsa-miR-3918	CLIP-seq
MIRT1288289	hsa-miR-4293	CLIP-seq
MIRT1288300	hsa-miR-4480	CLIP-seq
MIRT1288307	hsa-miR-4685-5p	CLIP-seq
MIRT1288321	hsa-miR-539	CLIP-seq
MIRT1288322	hsa-miR-544b	CLIP-seq
MIRT1288328	hsa-miR-936	CLIP-seq
MIRT2689294	hsa-miR-1273d	CLIP-seq
MIRT2689295	hsa-miR-127-3p	CLIP-seq
MIRT2689296	hsa-miR-1343	CLIP-seq
MIRT2689297	hsa-miR-486-3p	CLIP-seq

Show/Hide all (1)

Transcription factor	Regulation	Reference
YBX1	Activation	20596676

Show/Hide all (36)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000076	Process	DNA replication checkpoint signaling	IBA
GO:0000076	Process	DNA replication checkpoint signaling	TAS	8943031
GO:0000077	Process	DNA damage checkpoint signaling	IEA
GO:0000077	Process	DNA damage checkpoint signaling	IMP	21659603
GO:0000077	Process	DNA damage checkpoint signaling	NAS	19464297
GO:0000077	Process	DNA damage checkpoint signaling	TAS	8943031
GO:0004518	Function	Nuclease activity	IEA
GO:0004527	Function	Exonuclease activity	IEA
GO:0005515	Function	Protein binding	IPI	10359610, 10884395, 11971963, 14500360, 14624239, 15897895, 19464297, 20424596, 21659603, 28514442, 32296183, 33961781, 35271311
GO:0005634	Component	Nucleus	IDA	12628935
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IEA
GO:0006281	Process	DNA repair	IBA
GO:0006281	Process	DNA repair	IEA
GO:0006281	Process	DNA repair	TAS	8943031
GO:0006974	Process	DNA damage response	IDA	9872989
GO:0006974	Process	DNA damage response	IEA
GO:0008311	Function	Double-stranded DNA 3'-5' DNA exonuclease activity	IEA
GO:0008408	Function	3'-5' exonuclease activity	IDA	10713044
GO:0008630	Process	Intrinsic apoptotic signaling pathway in response to DNA damage	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0017124	Function	SH3 domain binding	IPI	11971963
GO:0019899	Function	Enzyme binding	IPI	15326225
GO:0019901	Function	Protein kinase binding	IPI	12628935
GO:0030896	Component	Checkpoint clamp complex	IBA
GO:0030896	Component	Checkpoint clamp complex	IDA	31776186, 36841485
GO:0030896	Component	Checkpoint clamp complex	IEA
GO:0030896	Component	Checkpoint clamp complex	IPI	19464297
GO:0031573	Process	Mitotic intra-S DNA damage checkpoint signaling	IBA
GO:0031573	Process	Mitotic intra-S DNA damage checkpoint signaling	IEA
GO:0042826	Function	Histone deacetylase binding	IPI	10846170
GO:0071479	Process	Cellular response to ionizing radiation	IBA
GO:0071479	Process	Cellular response to ionizing radiation	IDA	21659603
GO:1902231	Process	Positive regulation of intrinsic apoptotic signaling pathway in response to DNA damage	IEA

MIM	HGNC	e!Ensembl
603761	9827	ENSG00000172613

Q99638

Protein name

Cell cycle checkpoint control protein RAD9A (hRAD9) (EC 3.1.11.2) (DNA repair exonuclease rad9 homolog A)

Protein function

Component of the 9-1-1 cell-cycle checkpoint response complex that plays a major role in DNA repair (PubMed:10713044, PubMed:17575048, PubMed:20545769, PubMed:21659603, PubMed:31135337). The 9-1-1 complex is recruited to DNA lesion upon damage b

PDB

3A1J , 3G65 , 3GGR , 6HM5 , 6J8Y , 7Z6H , 8GNN , 8JZY , 8WU8

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF04139	Rad9	13 → 265	Rad9	Family

Sequence

MKCLVTGGNVKVLGKAVHSLSRIGDELYLEPLEDGLSLRTVNSSRSAYACFLFAPLFFQQ
YQAATPGQDLLRCKILMKSFLSVFRSLAMLEKTVEKCCISLNGRSSRLVVQLHCKFGVRK
THNLSFQDCESLQAVFDPASCPHMLRAPARVLGEAVLPFSPALAEVTLGIGRGRRVILRS
YHEEEADSTAKAMVTEMCLGEEDFQQLQAQEGVAITFCLKEFRGLLSFAESANLNLSIHF
DAPGRPAIFTIKDSLLDGHFVLATLSDTDSHSQDLGSPERHQPVPQLQAHSTPHPDDFAN
DDIDSYMIAMETTIGNEGSRVLPSISLSPGPQPPKSPGPHSEEEDEAEPSTVPGTPPPKK
FRSLFFGSILAPVRSPQGPSPVLAEDSEGEG

Sequence length

391

Interactions

View interactions

	KEGG		Reactome
	Cellular senescence		Activation of ATR in response to replication stress HDR through Single Strand Annealing (SSA) Processing of DNA double-strand break ends Presynaptic phase of homologous DNA pairing and strand exchange Regulation of TP53 Activity through Phosphorylation G2/M DNA damage checkpoint

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (3)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ATRIAL FIBRILLATION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS, HIP	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (31)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	16444745, 18949400, 20052722		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	16204032, 18616832, 25520248		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	16204032, 17511890, 18616832, 25520248, 31310624, 37684436	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	18949400, 20052722, 31310624		★★★★★ ★☆☆☆☆ Found in Text Mining only
COLD-INDUCED SWEATING SYNDROME 2	Cold-Induced Sweating Syndrome	CLINVAR_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital chromosomal disease	Congenital Chromosomal Disease	BEFREE	15773892		★★★★★ ★☆☆☆☆ Found in Text Mining only
Crisponi syndrome	Crisponi Syndrome	CLINVAR_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	26264615		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	26264615		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	26264615	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis B Chronic	Hepatitis b	Pubtator	40480312	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	18616832	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	16444745, 20052722	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	BEFREE	31310624		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Childhood Neoplasm	Malignant Neoplasm	BEFREE	21991345		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	16204032, 18616832, 25520248		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	26264615		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	18949400, 20052722, 24403312, 31310624		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	14966297, 16204032, 18316588, 21278450, 22034047, 25111005, 30295739		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of skin	Skin cancer	BEFREE	21278450		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	18616832, 18949400, 21278450		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	16204032		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	16204032, 16444745, 18616832, 21278450, 22034047, 24403312, 31310624		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	16444745, 18949400		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	14966297, 16204032, 18316588, 21278450, 22034047, 25111005, 30295739		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	14966297, 18316588		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	16204032, 25111005, 34298089	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	18316588		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	23066031, 30295739	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	16547620		★★★★★ ★☆☆☆☆ Found in Text Mining only
Treatment related secondary malignancy	Treatment Related Secondary Malignancy	CTD_human_DG	21991345		★★★★★ ★☆☆☆☆ Found in Text Mining only

RAD9A (RAD9 checkpoint clamp component A)