Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	58516
Gene name	SIN3-HDAC complex associated factor
Gene symbol	SINHCAF
Synonyms (NCBI Gene)	C12orf14FAM60AL4TERA
Chromosome	12
Chromosome location	12p11.21

Show/Hide all (82)

miRTarBase ID	miRNA	Experiments	Reference
MIRT703663	hsa-miR-495-5p	HITS-CLIP	23313552
MIRT703662	hsa-miR-34b-3p	HITS-CLIP	23313552
MIRT703661	hsa-miR-6808-5p	HITS-CLIP	23313552
MIRT703660	hsa-miR-6893-5p	HITS-CLIP	23313552
MIRT703659	hsa-miR-940	HITS-CLIP	23313552
MIRT703658	hsa-miR-3929	HITS-CLIP	23313552
MIRT703657	hsa-miR-4419b	HITS-CLIP	23313552
MIRT703656	hsa-miR-4478	HITS-CLIP	23313552
MIRT703655	hsa-miR-3614-5p	HITS-CLIP	23313552
MIRT703654	hsa-miR-6500-3p	HITS-CLIP	23313552
MIRT703653	hsa-miR-4768-3p	HITS-CLIP	23313552
MIRT703652	hsa-miR-1247-3p	HITS-CLIP	23313552
MIRT703651	hsa-miR-6746-5p	HITS-CLIP	23313552
MIRT703650	hsa-miR-4649-3p	HITS-CLIP	23313552
MIRT703649	hsa-miR-1827	HITS-CLIP	23313552
MIRT703648	hsa-miR-4722-5p	HITS-CLIP	23313552
MIRT703647	hsa-miR-7160-5p	HITS-CLIP	23313552
MIRT703646	hsa-miR-139-3p	HITS-CLIP	23313552
MIRT703645	hsa-miR-455-3p	HITS-CLIP	23313552
MIRT703644	hsa-miR-6516-5p	HITS-CLIP	23313552
MIRT703643	hsa-miR-665	HITS-CLIP	23313552
MIRT559915	hsa-miR-583	PAR-CLIP	20371350
MIRT559912	hsa-miR-1178-5p	PAR-CLIP	20371350
MIRT567617	hsa-miR-3613-3p	PAR-CLIP	20371350
MIRT559910	hsa-miR-4328	PAR-CLIP	20371350
MIRT567616	hsa-miR-371b-5p	PAR-CLIP	20371350
MIRT567615	hsa-miR-373-5p	PAR-CLIP	20371350
MIRT567614	hsa-miR-616-5p	PAR-CLIP	20371350
MIRT567613	hsa-miR-371a-5p	PAR-CLIP	20371350
MIRT567612	hsa-miR-372-5p	PAR-CLIP	20371350
MIRT559911	hsa-miR-223-3p	PAR-CLIP	20371350
MIRT559909	hsa-miR-4668-5p	PAR-CLIP	20371350
MIRT559907	hsa-miR-5087	PAR-CLIP	20371350
MIRT559915	hsa-miR-583	PAR-CLIP	20371350
MIRT559914	hsa-miR-208a-5p	PAR-CLIP	20371350
MIRT559913	hsa-miR-208b-5p	PAR-CLIP	20371350
MIRT567617	hsa-miR-3613-3p	PAR-CLIP	20371350
MIRT559910	hsa-miR-4328	PAR-CLIP	20371350
MIRT567616	hsa-miR-371b-5p	PAR-CLIP	20371350
MIRT567615	hsa-miR-373-5p	PAR-CLIP	20371350
MIRT567614	hsa-miR-616-5p	PAR-CLIP	20371350
MIRT567613	hsa-miR-371a-5p	PAR-CLIP	20371350
MIRT567612	hsa-miR-372-5p	PAR-CLIP	20371350
MIRT559909	hsa-miR-4668-5p	PAR-CLIP	20371350
MIRT559911	hsa-miR-223-3p	PAR-CLIP	20371350
MIRT559908	hsa-miR-3674	PAR-CLIP	20371350
MIRT559907	hsa-miR-5087	PAR-CLIP	20371350
MIRT559915	hsa-miR-583	PAR-CLIP	20371350
MIRT559914	hsa-miR-208a-5p	PAR-CLIP	20371350
MIRT559913	hsa-miR-208b-5p	PAR-CLIP	20371350
MIRT559912	hsa-miR-1178-5p	PAR-CLIP	20371350
MIRT559910	hsa-miR-4328	PAR-CLIP	20371350
MIRT559911	hsa-miR-223-3p	PAR-CLIP	20371350
MIRT559908	hsa-miR-3674	PAR-CLIP	20371350
MIRT559909	hsa-miR-4668-5p	PAR-CLIP	20371350
MIRT559907	hsa-miR-5087	PAR-CLIP	20371350
MIRT507323	hsa-miR-548n	PAR-CLIP	21572407
MIRT507322	hsa-miR-548az-5p	PAR-CLIP	21572407
MIRT507321	hsa-miR-548t-5p	PAR-CLIP	21572407
MIRT507320	hsa-miR-561-3p	PAR-CLIP	21572407
MIRT507319	hsa-miR-628-3p	PAR-CLIP	21572407
MIRT507317	hsa-miR-2052	PAR-CLIP	21572407
MIRT507323	hsa-miR-548n	PAR-CLIP	22012620
MIRT507322	hsa-miR-548az-5p	PAR-CLIP	22012620
MIRT507321	hsa-miR-548t-5p	PAR-CLIP	22012620
MIRT507320	hsa-miR-561-3p	PAR-CLIP	22012620
MIRT507319	hsa-miR-628-3p	PAR-CLIP	22012620
MIRT507317	hsa-miR-2052	PAR-CLIP	22012620
MIRT507323	hsa-miR-548n	PAR-CLIP	23446348
MIRT507322	hsa-miR-548az-5p	PAR-CLIP	23446348
MIRT507321	hsa-miR-548t-5p	PAR-CLIP	23446348
MIRT507320	hsa-miR-561-3p	PAR-CLIP	23446348
MIRT507319	hsa-miR-628-3p	PAR-CLIP	23446348
MIRT507317	hsa-miR-2052	PAR-CLIP	23446348
MIRT477012	hsa-miR-5692a	PAR-CLIP	23592263
MIRT477011	hsa-miR-4318	PAR-CLIP	23592263
MIRT477010	hsa-miR-325	PAR-CLIP	23592263
MIRT477009	hsa-miR-601	PAR-CLIP	23592263
MIRT477008	hsa-miR-380-5p	PAR-CLIP	23592263
MIRT477007	hsa-miR-563	PAR-CLIP	23592263
MIRT477006	hsa-miR-203a-5p	PAR-CLIP	23592263
MIRT477005	hsa-miR-1273g-5p	PAR-CLIP	23592263

Show/Hide all (17)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	NAS	22865885
GO:0005515	Function	Protein binding	IPI	23752268, 26496610, 28514442, 32296183, 33961781, 35271311
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	NAS	28554894
GO:0008284	Process	Positive regulation of cell population proliferation	IEA
GO:0008284	Process	Positive regulation of cell population proliferation	ISS
GO:0030336	Process	Negative regulation of cell migration	IBA
GO:0030336	Process	Negative regulation of cell migration	IMP	22984288
GO:0030336	Process	Negative regulation of cell migration	NAS	22984288
GO:0030512	Process	Negative regulation of transforming growth factor beta receptor signaling pathway	NAS	22984288
GO:0045596	Process	Negative regulation of cell differentiation	IEA
GO:0045596	Process	Negative regulation of cell differentiation	ISS
GO:0070822	Component	Sin3-type complex	IBA
GO:0070822	Component	Sin3-type complex	IDA	22984288
GO:0070822	Component	Sin3-type complex	NAS	28554894
GO:1902455	Process	Negative regulation of stem cell population maintenance	NAS	28554894
GO:1902459	Process	Positive regulation of stem cell population maintenance	NAS	28554894

MIM	HGNC	e!Ensembl
615027	30702	ENSG00000139146

Q9NP50

Protein name

SIN3-HDAC complex-associated factor (Protein FAM60A) (Tera protein homolog)

Protein function

Subunit of the Sin3 deacetylase complex (Sin3/HDAC), this subunit is important for the repression of genes encoding components of the TGF-beta signaling pathway (PubMed:22865885, PubMed:22984288). Core component of a SIN3A complex (composed of a

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF15396	FAM60A	2 → 198	Protein Family FAM60A	Family

Sequence

MFGFHKPKMYRSIEGCCICRAKSSSSRFTDSKRYEKDFQSCFGLHETRSGDICNACVLLV
KRWKKLPAGSKKNWNHVVDARAGPSLKTTLKPKKVKTLSGNRIKSNQISKLQKEFKRHNS
DAHSTTSSASPAQSPCYSNQSDDGSDTEMASGSNRTPVFSFLDLTYWKRQKICCGIIYKG
RFGEVLIDTHLFKPCCSNKKAAAEKPEEQGPEPLPISTQEW

Sequence length

221

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (4)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
CORONARY ARTERY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-SMALL CELL LUNG CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PANCREATIC NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (10)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Carcinoma of lung	Lung carcinoma	BEFREE	31727367		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	GWASCAT_DG	26818947, 30718926		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	28169357		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	28169357	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	31727367		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	31727367		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	31727367		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	37439040	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	31727367		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	31727367		★★★★★ ★☆☆☆☆ Found in Text Mining only

SINHCAF (SIN3-HDAC complex associated factor)