Gene Gene information from NCBI Gene database.
Entrez ID 58510
Gene name Proline dehydrogenase 2
Gene symbol PRODH2
Synonyms (NCBI Gene)
HSPOX1HYPDH
Chromosome 19
Chromosome location 19q13.12
Summary The protein encoded by this gene catalyzes the first step in the catabolism of trans-4-hydroxy-L-proline, an amino acid derivative obtained through food intake and collagen turnover. One of the downstream products of this catabolism is glyoxylate, which i
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
12
GO ID Ontology Definition Evidence Reference
GO:0004657 Function Proline dehydrogenase activity IBA
GO:0004657 Function Proline dehydrogenase activity IEA
GO:0004657 Function Proline dehydrogenase activity TAS
GO:0005739 Component Mitochondrion IBA
GO:0005743 Component Mitochondrial inner membrane TAS
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
616377 17325 ENSG00000250799
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9UF12
Protein name Hydroxyproline dehydrogenase (HYPDH) (EC 1.5.5.3) (Kidney and liver proline oxidase 1) (HsPOX1) (Probable proline dehydrogenase 2) (EC 1.5.5.2) (Probable proline oxidase 2)
Protein function Dehydrogenase that converts trans-4-L-hydroxyproline to delta-1-pyrroline-3-hydroxy-5-carboxylate (Hyp) using ubiquinone-10 as the terminal electron acceptor. Can also use proline as a substrate but with a very much lower efficiency. Does not re
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01619 Pro_dh 224 514 Proline dehydrogenase Family
Sequence
MSPRVVSNSSVLASQSVGITNVRTVFSNVFNNTTAFPILRGSNCHKITAPGLGKGQLVNL
LPPENLPWCGGSQGPRMLRTCYVLCSQAGPPSRGWQSLSFDGGAFHLKGTGELTRALLVL
RLCAWPPLVTHGLLLQAWSRRLLGSRLSGAFLRASVYGQFVAGETAEEVKGCVQQLRTLS
LRPLLAVPTEEEPDSAAKSGEAWYEGNLGAMLRCVDLSRGLLEPPSLAEASLMQLKVTAL
TSTRLCKELASWVRRPGASLELSPERLAEAMDSGQNLQVSCLNAEQNQHLRASLSRLHRV
AQYARAQHVRLLVDAEYTSLNPALSLLVAALAVRWNSPGEGGPWVWNTYQACLKDTFERL
GRDAEAAHRAGLAFGVKLVRGAYLDKERAVAQLHGMEDPTQPDYEATSQSYSRCLELMLT
HVARHGPMCHLMVASHNEESVRQATKRMWELGIPLDGTVCFGQLLGMCDHVSLALGQAGY
VVYKSIPYGSLEEVIPYLIRRAQENRSVLQGARR
EQELLSQELWRRLLPGCRRIPH
Sequence length 536
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Arginine and proline metabolism
Metabolic pathways
  Glyoxylate metabolism and glycine degradation
Proline catabolism
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
3
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
LIVER CIRRHOSIS, EXPERIMENTAL CTD
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
PRODH2-related disorder Likely benign; Benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA Disgenet
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Hyperoxaluria Hyperoxaluria Pubtator 25697095 Associate
★☆☆☆☆
Found in Text Mining only
Hyperoxaluria Primary Hyperoxaluria Pubtator 25697095 Associate
★☆☆☆☆
Found in Text Mining only
Intellectual Disability Mental retardation BEFREE 28720891
★☆☆☆☆
Found in Text Mining only
Leukocyte adhesion deficiency type 1 Leukocyte adhesion deficiency Pubtator 35276062 Associate
★☆☆☆☆
Found in Text Mining only
Primary Hyperoxaluria Hyperoxaluria BEFREE 25697095, 31821850
★☆☆☆☆
Found in Text Mining only
Schizophrenia Schizophrenia BEFREE 11891283, 28720891
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Schizophrenia Schizophrenia PSYGENET_DG 11891283
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Schizophrenia Schizophrenia Pubtator 28720891 Associate
★★☆☆☆
Found in Text Mining + Unknown/Other Associations