OPRPN (opiorphin prepropeptide)

Gene Gene information from NCBI Gene database.
Gene Gene ontology Other IDs Protein Associated diseases
Entrez ID 58503
Gene name Opiorphin prepropeptide
Gene symbol OPRPN
Synonyms (NCBI Gene)
BPLPPRL1PROL1opiorphin
Chromosome 4
Chromosome location 4q13.3
Summary This gene encodes a member of the proline-rich protein family. The encoded protein has multiple proposed functions, including roles in pain suppression, penile erection, and protection of the eye surface. The QRFSR pentapeptide, known as opiorphin, is der
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
9
Gene Gene ontology Other IDs Protein Associated diseases
Show/Hide all (9)
GO ID Ontology Definition Evidence Reference
GO:0004866 Function Endopeptidase inhibitor activity IBA
GO:0004866 Function Endopeptidase inhibitor activity IDA 17101991
GO:0005576 Component Extracellular region IDA 17101991
GO:0005576 Component Extracellular region IEA
GO:0005615 Component Extracellular space HDA 22664934, 23580065
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
Gene Gene ontology Other IDs Protein Associated diseases
MIM HGNC e!Ensembl
608936 17279 ENSG00000171199
Protein Protein information from UniProt database.
Gene Gene ontology Other IDs Protein Associated diseases
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q99935
Protein name Opiorphin prepropeptide (Basic proline-rich lacrimal protein) (Proline-rich protein 1) (PRL1) [Cleaved into: Opiorphin]
Protein function Opiorphin is an endogenous inhibitor of neprilysin and aminopeptidase N. Inhibits the breakdown of substance P, Mca-BK2 and Met-enkephalin by neprilysin in vitro with IC(50) values of 29 uM, 33 uM and 33 uM respectively. Inhibits the breakdown o
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF15621 PROL5-SMR 1 → 104 Proline-rich submaxillary gland androgen-regulated family Family
Tissue specificity TISSUE SPECIFICITY: Abundantly expressed in lacrimal gland where it found in the secretory endpieces. Also expressed at modest levels in the submandibular gland.
Sequence 
MKLTFFLGLLALISCFTPSESQRFSRRPYLPGQLPPPPLYRPRWVPPSPPPPYDSRLNSP
LSLPFVPGRVPPSSFSRFSQAVILSQLFPLESIRQPRLFPGYPNLHFPLRPYYVGPIRIL
KPPFPPIPFFLAIYLPISNPEPQINITTADTTITTNPPTTATATTSTSTKPTMTISSSTV
PISSTPEPATSISAATPAASTENTTQILANRPHTVLLNATVQVTTSNQTILSSPAFKSFW
QKLFAIFG
Sequence length 248
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
1
Gene Gene ontology Other IDs Protein Associated diseases
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Show/Hide Unknown Diseases (1)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
SARCOIDOSIS — GWAS catalog
★★★★★
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Show/Hide Text Mining Associations (17)
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Asthma Asthma Pubtator 35344278 Associate
★★★★★
★☆☆☆☆
Found in Text Mining only
Breast Carcinoma Breast Carcinoma BEFREE 29653288
★★★★★
★☆☆☆☆
Found in Text Mining only
Carcinoma of lung Lung carcinoma BEFREE 17234774, 20484558, 30462625
★★★★★
★☆☆☆☆
Found in Text Mining only
Diabetes Diabetes BEFREE 18410445
★★★★★
★☆☆☆☆
Found in Text Mining only
Diabetes Mellitus Diabetes Mellitus BEFREE 18410445
★★★★★
★☆☆☆☆
Found in Text Mining only
Dry Eye Syndromes Dry eye syndrome Pubtator 27436115 Associate
★★★★★
★☆☆☆☆
Found in Text Mining only
Erectile dysfunction Erectile Dysfunction BEFREE 18410445
★★★★★
★☆☆☆☆
Found in Text Mining only
Liver carcinoma Liver carcinoma BEFREE 25003523, 30661451
★★★★★
★☆☆☆☆
Found in Text Mining only
Liver Failure Liver failure BEFREE 31653075
★★★★★
★☆☆☆☆
Found in Text Mining only
Malignant neoplasm of breast Breast Cancer BEFREE 29653288
★★★★★
★☆☆☆☆
Found in Text Mining only