Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene SNPs miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	58495
Gene name	Ovo like zinc finger 2
Gene symbol	OVOL2
Synonyms (NCBI Gene)	CHEDCHED1CHED2EUROIMAGE566589PPCD1ZNF339
Chromosome	20
Chromosome location	20p11.23
Summary	This gene encodes a member of the evolutionarily conserved ovo-like protein family. Mammalian members of this family contain a single zinc finger domain composed of a tetrad of C2H2 zinc fingers with variable N- and C-terminal extensions that contain intr

Show/Hide all (4)

SNP ID	Visualize variation	Clinical significance	Consequence
rs869320627	->GGTTCCGGCGGCCGGGGCTGCC	Pathogenic	Intron variant, upstream transcript variant, genic upstream transcript variant
rs869320628	A>G	Pathogenic	Intron variant, upstream transcript variant, genic upstream transcript variant
rs869320629	A>G	Pathogenic	Intron variant, upstream transcript variant, genic upstream transcript variant
rs869320630	A>C	Pathogenic	Intron variant, 5 prime UTR variant

Show/Hide all (97)

miRTarBase ID	miRNA	Experiments
MIRT1208409	hsa-miR-1197	CLIP-seq
MIRT1208410	hsa-miR-1237	CLIP-seq
MIRT1208411	hsa-miR-1248	CLIP-seq
MIRT1208412	hsa-miR-1275	CLIP-seq
MIRT1208413	hsa-miR-188-3p	CLIP-seq
MIRT1208414	hsa-miR-2116	CLIP-seq
MIRT1208415	hsa-miR-2861	CLIP-seq
MIRT1208416	hsa-miR-30a	CLIP-seq
MIRT1208417	hsa-miR-30b	CLIP-seq
MIRT1208418	hsa-miR-30c	CLIP-seq
MIRT1208419	hsa-miR-30d	CLIP-seq
MIRT1208420	hsa-miR-30e	CLIP-seq
MIRT1208421	hsa-miR-3127-3p	CLIP-seq
MIRT1208422	hsa-miR-3148	CLIP-seq
MIRT1208423	hsa-miR-3187-3p	CLIP-seq
MIRT1208424	hsa-miR-3189-3p	CLIP-seq
MIRT1208425	hsa-miR-3607-3p	CLIP-seq
MIRT1208426	hsa-miR-362-5p	CLIP-seq
MIRT1208427	hsa-miR-3667-3p	CLIP-seq
MIRT1208428	hsa-miR-3686	CLIP-seq
MIRT1208429	hsa-miR-3909	CLIP-seq
MIRT1208430	hsa-miR-3918	CLIP-seq
MIRT1208431	hsa-miR-3942-3p	CLIP-seq
MIRT1208432	hsa-miR-4435	CLIP-seq
MIRT1208433	hsa-miR-4436a	CLIP-seq
MIRT1208434	hsa-miR-4512	CLIP-seq
MIRT1208435	hsa-miR-4525	CLIP-seq
MIRT1208436	hsa-miR-4529-5p	CLIP-seq
MIRT1208437	hsa-miR-4652-3p	CLIP-seq
MIRT1208438	hsa-miR-4665-5p	CLIP-seq
MIRT1208439	hsa-miR-4668-3p	CLIP-seq
MIRT1208440	hsa-miR-4668-5p	CLIP-seq
MIRT1208441	hsa-miR-4677-5p	CLIP-seq
MIRT1208442	hsa-miR-4700-3p	CLIP-seq
MIRT1208443	hsa-miR-4701-5p	CLIP-seq
MIRT1208444	hsa-miR-4723-5p	CLIP-seq
MIRT1208445	hsa-miR-495	CLIP-seq
MIRT1208446	hsa-miR-500a	CLIP-seq
MIRT1208447	hsa-miR-500b	CLIP-seq
MIRT1208448	hsa-miR-5095	CLIP-seq
MIRT1208449	hsa-miR-548c-3p	CLIP-seq
MIRT1208450	hsa-miR-548s	CLIP-seq
MIRT1208451	hsa-miR-588	CLIP-seq
MIRT1208452	hsa-miR-605	CLIP-seq
MIRT1208453	hsa-miR-625	CLIP-seq
MIRT1208410	hsa-miR-1237	CLIP-seq
MIRT2059874	hsa-miR-124	CLIP-seq
MIRT1208411	hsa-miR-1248	CLIP-seq
MIRT2059875	hsa-miR-1272	CLIP-seq
MIRT1208421	hsa-miR-3127-3p	CLIP-seq
MIRT2059876	hsa-miR-3163	CLIP-seq
MIRT2059877	hsa-miR-3662	CLIP-seq
MIRT1208427	hsa-miR-3667-3p	CLIP-seq
MIRT2059878	hsa-miR-3682-3p	CLIP-seq
MIRT1208429	hsa-miR-3909	CLIP-seq
MIRT2059879	hsa-miR-4310	CLIP-seq
MIRT2059880	hsa-miR-4695-3p	CLIP-seq
MIRT2059881	hsa-miR-498	CLIP-seq
MIRT2059882	hsa-miR-506	CLIP-seq
MIRT2059883	hsa-miR-767-5p	CLIP-seq
MIRT2288213	hsa-miR-1	CLIP-seq
MIRT2288214	hsa-miR-1257	CLIP-seq
MIRT2288215	hsa-miR-206	CLIP-seq
MIRT1208415	hsa-miR-2861	CLIP-seq
MIRT2288216	hsa-miR-337-5p	CLIP-seq
MIRT2288217	hsa-miR-3673	CLIP-seq
MIRT1208430	hsa-miR-3918	CLIP-seq
MIRT2288218	hsa-miR-432	CLIP-seq
MIRT2288219	hsa-miR-4485	CLIP-seq
MIRT1208434	hsa-miR-4512	CLIP-seq
MIRT1208445	hsa-miR-495	CLIP-seq
MIRT1208448	hsa-miR-5095	CLIP-seq
MIRT2288220	hsa-miR-548al	CLIP-seq
MIRT2288221	hsa-miR-570	CLIP-seq
MIRT2288222	hsa-miR-613	CLIP-seq
MIRT2288223	hsa-miR-9	CLIP-seq
MIRT1208410	hsa-miR-1237	CLIP-seq
MIRT1208411	hsa-miR-1248	CLIP-seq
MIRT1208412	hsa-miR-1275	CLIP-seq
MIRT1208421	hsa-miR-3127-3p	CLIP-seq
MIRT2392008	hsa-miR-342-5p	CLIP-seq
MIRT2392009	hsa-miR-3653	CLIP-seq
MIRT1208427	hsa-miR-3667-3p	CLIP-seq
MIRT1208429	hsa-miR-3909	CLIP-seq
MIRT2392010	hsa-miR-4271	CLIP-seq
MIRT2392011	hsa-miR-4447	CLIP-seq
MIRT2392012	hsa-miR-4472	CLIP-seq
MIRT1208435	hsa-miR-4525	CLIP-seq
MIRT2392013	hsa-miR-4651	CLIP-seq
MIRT2392014	hsa-miR-4664-5p	CLIP-seq
MIRT1208438	hsa-miR-4665-5p	CLIP-seq
MIRT2392015	hsa-miR-4676-5p	CLIP-seq
MIRT1208444	hsa-miR-4723-5p	CLIP-seq
MIRT2392016	hsa-miR-4725-3p	CLIP-seq
MIRT2392017	hsa-miR-575	CLIP-seq
MIRT2392018	hsa-miR-608	CLIP-seq
MIRT1208453	hsa-miR-625	CLIP-seq

Show/Hide all (60)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	IEA
GO:0000976	Function	Transcription cis-regulatory region binding	IDA	19700410
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0001227	Function	DNA-binding transcription repressor activity, RNA polymerase II-specific	IEA
GO:0001227	Function	DNA-binding transcription repressor activity, RNA polymerase II-specific	ISS
GO:0001228	Function	DNA-binding transcription activator activity, RNA polymerase II-specific	IEA
GO:0001525	Process	Angiogenesis	IEA
GO:0001755	Process	Neural crest cell migration	IEA
GO:0001842	Process	Neural fold formation	IEA
GO:0001947	Process	Heart looping	IEA
GO:0003677	Function	DNA binding	IEA
GO:0003682	Function	Chromatin binding	IEA
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IC	19700410
GO:0005634	Component	Nucleus	IEA
GO:0005634	Component	Nucleus	ISS
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0007507	Process	Heart development	IEA
GO:0008270	Function	Zinc ion binding	IEA
GO:0008283	Process	Cell population proliferation	IEA
GO:0008285	Process	Negative regulation of cell population proliferation	IEA
GO:0008544	Process	Epidermis development	IEA
GO:0009913	Process	Epidermal cell differentiation	IBA
GO:0009913	Process	Epidermal cell differentiation	IEA
GO:0009953	Process	Dorsal/ventral pattern formation	IEA
GO:0009968	Process	Negative regulation of signal transduction	IEA
GO:0010628	Process	Positive regulation of gene expression	IEA
GO:0010628	Process	Positive regulation of gene expression	ISS
GO:0010629	Process	Negative regulation of gene expression	IEA
GO:0010629	Process	Negative regulation of gene expression	ISS
GO:0010719	Process	Negative regulation of epithelial to mesenchymal transition	IEA
GO:0010719	Process	Negative regulation of epithelial to mesenchymal transition	ISS
GO:0010719	Process	Negative regulation of epithelial to mesenchymal transition	TAS	28455959
GO:0010837	Process	Regulation of keratinocyte proliferation	IEA
GO:0010837	Process	Regulation of keratinocyte proliferation	IMP	19700410
GO:0010944	Process	Negative regulation of transcription by competitive promoter binding	IDA	19700410
GO:0030512	Process	Negative regulation of transforming growth factor beta receptor signaling pathway	IEA
GO:0030512	Process	Negative regulation of transforming growth factor beta receptor signaling pathway	ISS
GO:0045596	Process	Negative regulation of cell differentiation	IEA
GO:0045616	Process	Regulation of keratinocyte differentiation	IEA
GO:0045617	Process	Negative regulation of keratinocyte differentiation	IMP	19700410
GO:0045618	Process	Positive regulation of keratinocyte differentiation	IEA
GO:0045746	Process	Negative regulation of Notch signaling pathway	IDA	19700410
GO:0045892	Process	Negative regulation of DNA-templated transcription	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0048557	Process	Embryonic digestive tract morphogenesis	IEA
GO:0051241	Process	Negative regulation of multicellular organismal process	IEA
GO:0051726	Process	Regulation of cell cycle	IMP	19700410
GO:0060214	Process	Endocardium formation	IEA
GO:0060347	Process	Heart trabecula formation	IEA
GO:0060392	Process	Negative regulation of SMAD protein signal transduction	IEA
GO:0060392	Process	Negative regulation of SMAD protein signal transduction	ISS
GO:0060716	Process	Labyrinthine layer blood vessel development	IEA
GO:0070343	Process	White fat cell proliferation	ISS	36228616
GO:0120162	Process	Positive regulation of cold-induced thermogenesis	ISS	24703692
GO:1990837	Function	Sequence-specific double-stranded DNA binding	IDA	28473536
GO:2000647	Process	Negative regulation of stem cell proliferation	IEA

MIM	HGNC	e!Ensembl
616441	15804	ENSG00000125850

Q9BRP0

Protein name

Transcription factor Ovo-like 2 (hOvo2) (Zinc finger protein 339)

Protein function

Zinc-finger transcription repressor factor (PubMed:19700410). Plays a critical role in maintaining the identity of epithelial lineages by suppressing epithelial-to mesenchymal transition (EMT) mainly through the repression of ZEB1, an EMT induce

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF13894	zf-C2H2_4	147 → 170		Domain
PF00096	zf-C2H2	175 → 198	Zinc finger, C2H2 type	Domain
PF00096	zf-C2H2	214 → 237	Zinc finger, C2H2 type	Domain

Tissue specificity

TISSUE SPECIFICITY: Expressed in testis, ovary, heart and skeletal muscle (PubMed:12213202). Expressed in the cornea, but absent from the corneal endothelium (PubMed:26749309). {ECO:0000269|PubMed:12213202, ECO:0000269|PubMed:26749309}.

Sequence

MPKVFLVKRRSLGVSVRSWDELPDEKRADTYIPVGLGRLLHDPPEDCRSDGGSSSGSGSS
SAGEPGGAESSSSPHAPESETPEPGDAEGPDGHLATKQRPVARSKIKFTTGTCSDSVVHS
CDLCGKGFRLQRMLNRHLKCHNQVKRHLCTFCGKGFNDTFDLKRHVRTHTGIRPYKCNVC
NKAFTQRCSLESHLKKIHGVQQQYAYKQRRDKLYVCEDCGYTGPTQEDLYLHVNSAHPGS
SFLKKTSKKLAALLQGKLTSAHQENTSLSEEEERK

Sequence length

275

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Posterior polymorphous corneal dystrophy 1	Pathogenic	rs869320627, rs869320628, rs869320629, rs869320630	RCV000210432 RCV000210419 RCV000210427 RCV000210412	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Show/Hide Unknown Diseases (9)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ALZHEIMER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONGENITAL HEREDITARY ENDOTHELIAL DYSTROPHY TYPE 1	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONGENITAL HEREDITARY ENDOTHELIAL DYSTROPHY TYPE I	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORNEAL DYSTROPHY, POSTERIOR POLYMORPHOUS, 1	—	CTD, Disgenet, HPO CTD, Disgenet, HPO CTD, Disgenet, HPO	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEREDITARY CORNEAL DYSTROPHY	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVOL2-related disorder	Likely benign; Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PERIPHERAL ARTERIAL DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
POLYMORPHOUS CORNEAL DYSTROPHY	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
POSTERIOR POLYMORPHOUS CORNEAL DYSTROPHY	—	GWAS catalog, Orphanet GWAS catalog, Orphanet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (59)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	27884772		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anaplasia	Anaplasia	BEFREE	29721073		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anterior synechiae	Synechiae	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Bowen's Disease		Pubtator	28339425	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	28455959		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	38066300	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	37138231	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	26619963		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	36149163	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	28339425	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebellar atrophy	Cerebellar atrophy	CLINVAR_DG	28711739		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chandler syndrome	Chandler Syndrome	BEFREE	16825429		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	26619963		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	BEFREE	26619963		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital hereditary endothelial dystrophy	Congenital Hereditary Endothelial Dystrophy	BEFREE	10512674, 12654361, 17679935, 19574904, 25564336, 26749309		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital hereditary endothelial dystrophy	Congenital Hereditary Endothelial Dystrophy	ORPHANET_DG	26749309		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital hereditary endothelial dystrophy type I	Congenital Hereditary Endothelial Dystrophy	Orphanet			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Corneal Diseases	Corneal Diseases	BEFREE	17679935		★★★★★ ★☆☆☆☆ Found in Text Mining only
Corneal dystrophy	Corneal Dystrophy	BEFREE	22072594, 23813972, 25564336		★★★★★ ★☆☆☆☆ Found in Text Mining only
CORNEAL DYSTROPHY AND PERCEPTIVE DEAFNESS	CORNEAL DYSTROPHY AND PERCEPTIVE DEAFNESS	BEFREE	17220209, 22072594, 24916015		★★★★★ ★☆☆☆☆ Found in Text Mining only
Corneal Dystrophy Posterior Polymorphous 1	Posterior polymorphous corneal dystrophy	Pubtator	19574904, 26749309, 27355326, 28046031, 28654985, 29499165	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Corneal Dystrophy, Band-Shaped	Corneal Dystrophy	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
CORNEAL ENDOTHELIAL DYSTROPHY 1, AUTOSOMAL DOMINANT	CORNEAL ENDOTHELIAL DYSTROPHY	BEFREE	12654361, 20808945, 25564336, 27310661, 28046031, 31201376, 31233731		★★★★★ ★☆☆☆☆ Found in Text Mining only
CORNEAL ENDOTHELIAL DYSTROPHY 1, AUTOSOMAL DOMINANT	CORNEAL ENDOTHELIAL DYSTROPHY	GENOMICS_ENGLAND_DG	26749309		★★★★★ ★☆☆☆☆ Found in Text Mining only
CORNEAL ENDOTHELIAL DYSTROPHY 1, AUTOSOMAL DOMINANT	CORNEAL ENDOTHELIAL DYSTROPHY	CTD_human_DG	26749309		★★★★★ ★☆☆☆☆ Found in Text Mining only
CORNEAL ENDOTHELIAL DYSTROPHY 1, AUTOSOMAL DOMINANT	CORNEAL ENDOTHELIAL DYSTROPHY	CLINVAR_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
CORNEAL ENDOTHELIAL DYSTROPHY 2	CORNEAL ENDOTHELIAL DYSTROPHY	BEFREE	16825429, 24502824		★★★★★ ★☆☆☆☆ Found in Text Mining only
Corneal endothelial dystrophy type 2	Corneal endothelial dystrophy	Pubtator	26749309, 40225920	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ectropion uveae	Ectropion Uveae	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Epithelioma	Epithelioma	BEFREE	28339425		★★★★★ ★☆☆☆☆ Found in Text Mining only
Excessive tearing	Excessive Tearing	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Fuchs Endothelial Dystrophy	Fuchs Endothelial Dystrophy	BEFREE	23662738, 23813972, 24916015		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	HPO_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Hair Diseases	Hair Diseases	BEFREE	26873447		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	29872308, 31401394		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	28455959		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	29872308		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	24124593, 28339425, 29721073		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	28455959		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	29454536		★★★★★ ★☆☆☆☆ Found in Text Mining only
MITOCHONDRIAL DNA DEPLETION SYNDROME 11	Mitochondrial DNA Deletion Syndrome	CLINVAR_DG	28711739		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	29721073, 29721076		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	29721073	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	26619963, 28339425, 29872308, 30542118		★★★★★ ★☆☆☆☆ Found in Text Mining only
Niemann-Pick Disease, Type C	Niemann-Pick Disease	BEFREE	29721076		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	29872308		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pilomatrixoma	Pilomatrixoma	BEFREE	26873447		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pilomatrixoma	Pilomatrixoma	CTD_human_DG	26873447		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polymorphous corneal dystrophy	Polymorphous corneal dystrophy	BEFREE	12654361, 18253095, 19574904, 20808945, 23559851, 25564336, 27310661, 28046031, 28414732, 31201376, 31233731		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Polymorphous corneal dystrophy	Polymorphous corneal dystrophy	ORPHANET_DG	26749309		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Polymorphous corneal dystrophy	Polymorphous corneal dystrophy	HPO_DG			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Posterior polymorphous corneal dystrophy	Polymorphous corneal dystrophy	Orphanet			★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Progressive cerebellar ataxia	Cerebellar Ataxia	CLINVAR_DG	28711739		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	29872308		★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Skin Neoplasms	BEFREE	29454536		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	28339425, 29454536		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of skin	Skin carcinoma	BEFREE	28339425		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	35082283	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Carcinoma Anaplastic	Thyroid cancer	Pubtator	35337349	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only

OVOL2 (ovo like zinc finger 2)