ZNF77 (zinc finger protein 77)

Gene

• Entrez ID: 58492
• Gene name: Zinc finger protein 77
• Gene symbol: ZNF77
• Synonyms (NCBI Gene): pT1
• Chromosome: 19
• Chromosome location: 19p13.3

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT036607	hsa-miR-940	CLASH	23622248
MIRT1539189	hsa-miR-1827	CLIP-seq
MIRT1539190	hsa-miR-34b	CLIP-seq
MIRT1539191	hsa-miR-34c-3p	CLIP-seq
MIRT1539192	hsa-miR-3929	CLIP-seq
MIRT1539193	hsa-miR-4419b	CLIP-seq
MIRT1539194	hsa-miR-4477a	CLIP-seq
MIRT1539195	hsa-miR-4478	CLIP-seq
MIRT1539196	hsa-miR-4649-3p	CLIP-seq
MIRT2162888	hsa-miR-150	CLIP-seq
MIRT2162889	hsa-miR-1915	CLIP-seq
MIRT1539194	hsa-miR-4477a	CLIP-seq
MIRT2162890	hsa-miR-4639-3p	CLIP-seq
MIRT2162891	hsa-miR-4713-5p	CLIP-seq
MIRT2162892	hsa-miR-4726-3p	CLIP-seq
MIRT2162893	hsa-miR-4742-3p	CLIP-seq
MIRT2162894	hsa-miR-532-3p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000977	Function	RNA polymerase II transcription regulatory region sequence-specific DNA binding	IBA
GO:0000981	Function	DNA-binding transcription factor activity, RNA polymerase II-specific	IBA
GO:0003677	Function	DNA binding	IEA
GO:0005515	Function	Protein binding	IPI	32296183
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0006355	Process	Regulation of DNA-templated transcription	IEA
GO:0006357	Process	Regulation of transcription by RNA polymerase II	IBA
GO:0008270	Function	Zinc ion binding	IEA
GO:0046872	Function	Metal ion binding	IEA

Other IDs

• MIM: 194551
• HGNC: 13150
• e!Ensembl: ENSG00000175691

Protein

• UniProt ID: Q15935
• Protein name: Zinc finger protein 77 (ZNFpT1)
• Protein function: May be involved in transcriptional regulation.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01352	KRAB	3 → 44	KRAB box	Family
  PF00096	zf-C2H2	240 → 262	Zinc finger, C2H2 type	Domain
  PF00096	zf-C2H2	268 → 290	Zinc finger, C2H2 type	Domain
  PF13894	zf-C2H2_4	296 → 319		Domain
  PF00096	zf-C2H2	352 → 374	Zinc finger, C2H2 type	Domain
  PF00096	zf-C2H2	408 → 430	Zinc finger, C2H2 type	Domain
  PF00096	zf-C2H2	464 → 486	Zinc finger, C2H2 type	Domain
  PF13894	zf-C2H2_4	492 → 515		Domain
  PF00096	zf-C2H2	520 → 542	Zinc finger, C2H2 type	Domain

• Sequence:

  MDCVIFEEVAVNFTPEEWALLDHAQRSLYRDVMLETCRNLASLDCYIYVRTSGSSSQRDV
  FGNGISNDEEIVKFTGSDSWSIFGENWRFDNTGDQHQIPQRHLRSQLGRLCESNEGHQCG
  ETLSQTANLLVHKSYPTEAKPSECTKCGKAFENRQRSHTGQRPCKECGQACSCLSCQSPP
  MKTQTVEKPCNCQDSRTASVTYVKSLSSKKSYECQKCGKAFICPSSFRGHVNSHHGQKTH
  ACKVCGKTFMYYSYLTRHVRTHTGEKPYECKECGKAFSCPSYFREHVRTHTGEKPYECKH
  CGKSFSCYSSFRDHVRTHTGEKPCQCKHCGKAFTCYSSLREHGRTHSGEKPYECKECGKA
  FRYPSSLRAHMRMHTGEKPYVCKQCGKAFGCPTYFRRHVKTHSGVKPYQCKECGKAYSFS
  SSLRIHVRTHTGEKPFECKHCGKAFSCHSSLREHVRTHSGEKPYECNQCGKAFSHAQYFQ
  KHVRSHSGVKPYECTECGKAYSCSSSLRVHVRTHTGERPYECKQCGKTFRYLASLQAHVR
  THAGA

• Sequence length: 545

Pathways

Reactome:

Generic Transcription Pathway

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ALZHEIMER'S DISEASE NEUROPATHOLOGIC CHANGE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC KIDNEY DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEMENTIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL INFARCTION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OLIGODENDROGLIOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STROKE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Agammaglobulinemia	Agammaglobulinemia	Pubtator	25569260	Associate	★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	30237437	Associate	★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	25569260	Associate	★☆☆☆☆ Found in Text Mining only
Autoimmune Lymphoproliferative Syndrome	Autoimmune lymphoproliferative disorder	Pubtator	25814141	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	28365938	Associate	★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	30226566		★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	Pubtator	30365130	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	27210502	Associate	★☆☆☆☆ Found in Text Mining only
Hypertension Pulmonary	Pulmonary hypertension	Pubtator	25814141	Associate	★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	30226566		★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune system disease	Pubtator	25814141	Associate	★☆☆☆☆ Found in Text Mining only
Myasthenic Syndromes Congenital	Myasthenic syndrome	Pubtator	27375219	Stimulate	★☆☆☆☆ Found in Text Mining only
Myasthenic Syndromes Congenital	Myasthenic syndrome	Pubtator	27375219	Associate	★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	30226566		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Infarction	Myocardial infarction	Pubtator	30226566	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Necrosis	Necrosis	Pubtator	21984918	Associate	★☆☆☆☆ Found in Text Mining only
Thrombocytopenia	Thrombocytopenia	Pubtator	33217855	Associate	★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	28092306		★☆☆☆☆ Found in Text Mining only