Gene Gene information from NCBI Gene database.
Entrez ID 582
Gene name Bardet-Biedl syndrome 1
Gene symbol BBS1
Synonyms (NCBI Gene)
BBS2L2
Chromosome 11
Chromosome location 11q13.2
Summary Mutations in this gene have been observed in patients with the major form (type 1) of Bardet-Biedl syndrome. The encoded protein may play a role in eye, limb, cardiac and reproductive system development. [provided by RefSeq, Jul 2008]
SNPs SNP information provided by dbSNP.
28
SNP ID Visualize variation Clinical significance Consequence
rs113994178 AAGATGGCCGCTGCGTCCTCATCGGATTCCGACGCCTGCG>- Pathogenic 5 prime UTR variant, frameshift variant, initiator codon variant
rs146052054 T>G Conflicting-interpretations-of-pathogenicity, uncertain-significance Coding sequence variant, missense variant
rs200688985 G>A Likely-pathogenic Coding sequence variant, missense variant
rs376894444 G>A Pathogenic-likely-pathogenic, likely-pathogenic Missense variant, coding sequence variant
rs587777829 G>A Pathogenic, likely-pathogenic Splice donor variant
miRNA miRNA information provided by mirtarbase database.
365
miRTarBase ID miRNA Experiments Reference
MIRT626384 hsa-miR-3692-5p HITS-CLIP 23824327
MIRT626383 hsa-miR-6861-5p HITS-CLIP 23824327
MIRT626382 hsa-miR-5002-3p HITS-CLIP 23824327
MIRT626381 hsa-miR-4731-5p HITS-CLIP 23824327
MIRT626380 hsa-miR-5589-5p HITS-CLIP 23824327
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
68
GO ID Ontology Definition Evidence Reference
GO:0000226 Process Microtubule cytoskeleton organization IEA
GO:0001764 Process Neuron migration IEA
GO:0001895 Process Retina homeostasis IEA
GO:0001895 Process Retina homeostasis IEA
GO:0005102 Function Signaling receptor binding IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
209901 966 ENSG00000174483
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q8NFJ9
Protein name BBSome complex member BBS1 (BBS2-like protein 2) (Bardet-Biedl syndrome 1 protein)
Protein function The BBSome complex is thought to function as a coat complex required for sorting of specific membrane proteins to the primary cilia. The BBSome complex is required for ciliogenesis but is dispensable for centriolar satellite function. This cilio
PDB 6XT9
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF14779 BBS1 23 276 Ciliary BBSome complex subunit 1 Family
Tissue specificity TISSUE SPECIFICITY: Highly expressed in the kidney. Also found in fetal tissue, testis, retina, adipose tissue, heart, skeletal muscle and pancreas.
Sequence
MAAASSSDSDACGAESNEANSKWLDAHYDPMANIHTFSACLALADLHGDGEYKLVVGDLG
PGGQQPRLKVLKGPLVMTESPLPALPAAAATFLMEQHEPRTPALALASGPCVYVYKNLRP
YFKFSLPQLPPNPLEQDLWNQAKEDRIDPLTLKEMLESIRETAEEPLSIQSLRFLQLELS
EMEAFVNQHKSNSIKRQTVITTMTTLKKNLADEDAVSCLVLGTENKELLVLDPEAFTILA
KMSLPSVPVFLEVSGQFDVEFRLAAACRNGNIYILR
RDSKHPKYCIELSAQPVGLIRVHK
VLVVGSTQDSLHGFTHKGKKLWTVQMPAAILTMNLLEQHSRGLQAVMAGLANGEVRIYRD
KALLNVIHTPDAVTSLCFGRYGREDNTLIMTTRGGGLIIKILKRTAVFVEGGSEVGPPPA
QAMKLNVPRKTRLYVDQTLREREAGTAMHRAFQTDLYLLRLRAARAYLQALESSLSPLST
TAREPLKLHAVVQGLGPTFKLTLHLQNTSTTRPVLGLLVCFLYNEALYSLPRAFFKVPLL
VPGLNYPLETFVESLSNKGISDIIKVLVLREGQSAPLLSAHVNMPGSEGLAAA
Sequence length 593
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  Reactome
    BBSome-mediated cargo-targeting to cilium
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
24
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Phenotype Name Clinical Significance dbSNP ID RCV Accession Evidence Score
Bardet-Biedl syndrome Pathogenic; Likely pathogenic rs1855937296, rs769820955, rs2134771570, rs2134771631, rs1856209517, rs2134797289, rs1856520165, rs1856788934, rs777143614, rs751753112, rs1475257145, rs1166459319, rs2134841394, rs2134780429, rs1434577015
View all (111 more)
RCV002670834
RCV001340368
RCV001387771
RCV001383137
RCV001388588
View all (127 more)
★★★★★
ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Bardet-Biedl syndrome 1 Pathogenic; Likely pathogenic rs746875134, rs769820955, rs2134771570, rs1856520165, rs751753112, rs2134784600, rs1475257145, rs2134765690, rs1166459319, rs2134780429, rs1434577015, rs1348187150, rs1306821707, rs2134837160, rs2495779138
View all (105 more)
RCV001329988
RCV004570814
RCV003463020
RCV005050371
RCV001730053
View all (124 more)
★★★★★
ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
BBS1-related disorder Likely pathogenic; Pathogenic rs2134836650, rs1348187150, rs786204444, rs768443448, rs777765120, rs878855095, rs113624356, rs121917777, rs587777829, rs587777830, rs376894444, rs1057517143, rs775769424, rs183771956, rs1490351829
View all (2 more)
RCV004729009
RCV004744211
RCV003398862
RCV004742303
RCV004744587
View all (12 more)
★★★★★
ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)
Familial cancer of breast Likely pathogenic rs200335137 RCV005927728
★★★★☆
ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
Acute myeloid leukemia Benign; Uncertain significance ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Bardet-Biedl syndrome 1/7, digenic Benign; Likely benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
BBS1-related ciliopathy Uncertain significance; Benign; Likely benign; Conflicting classifications of pathogenicity ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Cholangiocarcinoma Likely benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Albinism Albinism Pubtator 39596324 Associate
★☆☆☆☆
Found in Text Mining only
Apraxia of Phonation Apraxia CLINVAR_DG
★☆☆☆☆
Found in Text Mining only
Asperger Syndrome Asperger syndrome Pubtator 22940089 Associate
★☆☆☆☆
Found in Text Mining only
Asthma Asthma CLINVAR_DG
★☆☆☆☆
Found in Text Mining only
Asthma Asthma HPO_DG
★☆☆☆☆
Found in Text Mining only
Astigmatism Astigmatism HPO_DG
★☆☆☆☆
Found in Text Mining only
Astigmatism Astigmatism CLINVAR_DG
★☆☆☆☆
Found in Text Mining only
Atresia of vagina Atresia Of Vagina HPO_DG
★☆☆☆☆
Found in Text Mining only
Atrophy Atrophy Pubtator 22940089 Associate
★☆☆☆☆
Found in Text Mining only
Bardet-Biedl Syndrome Bardet-Biedl Syndrome BEFREE 10973251, 11050632, 12016587, 12118255, 12524598, 12677556, 12872256, 15266619, 15666242, 16823392, 17065520, 17980398, 18669544, 18766993, 21209035
View all (18 more)
★★★★★
ClinVar: Pathogenic / Likely Pathogenic (≥5 Variants)