Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	58191
Gene name	C-X-C motif chemokine ligand 16
Gene symbol	CXCL16
Synonyms (NCBI Gene)	CXCLG16SR-PSOXSRPSOX
Chromosome	17
Chromosome location	17p13.2

253

Show/Hide all (253)

miRTarBase ID	miRNA	Experiments	Reference
MIRT019098	hsa-miR-335-5p	Microarray	18185580
MIRT049831	hsa-miR-92a-3p	CLASH	23622248
MIRT037621	hsa-miR-744-5p	CLASH	23622248
MIRT460129	hsa-miR-490-3p	PAR-CLIP	23592263
MIRT460128	hsa-miR-7851-3p	PAR-CLIP	23592263
MIRT460127	hsa-miR-5694	PAR-CLIP	23592263
MIRT460126	hsa-miR-3192-5p	PAR-CLIP	23592263
MIRT460125	hsa-miR-1273f	PAR-CLIP	23592263
MIRT460124	hsa-miR-4537	PAR-CLIP	23592263
MIRT460123	hsa-miR-6499-3p	PAR-CLIP	23592263
MIRT460122	hsa-miR-6878-5p	PAR-CLIP	23592263
MIRT460121	hsa-miR-6731-5p	PAR-CLIP	23592263
MIRT460120	hsa-miR-8085	PAR-CLIP	23592263
MIRT460119	hsa-miR-6835-5p	PAR-CLIP	23592263
MIRT460118	hsa-miR-6752-5p	PAR-CLIP	23592263
MIRT460117	hsa-miR-6842-5p	PAR-CLIP	23592263
MIRT460116	hsa-miR-7110-5p	PAR-CLIP	23592263
MIRT460115	hsa-miR-455-3p	PAR-CLIP	23592263
MIRT460114	hsa-miR-30c-1-3p	PAR-CLIP	23592263
MIRT460113	hsa-miR-30c-2-3p	PAR-CLIP	23592263
MIRT460112	hsa-miR-6788-5p	PAR-CLIP	23592263
MIRT460111	hsa-miR-6751-5p	PAR-CLIP	23592263
MIRT460110	hsa-miR-6803-5p	PAR-CLIP	23592263
MIRT460109	hsa-miR-6516-5p	PAR-CLIP	23592263
MIRT460108	hsa-miR-6870-5p	PAR-CLIP	23592263
MIRT460129	hsa-miR-490-3p	PAR-CLIP	23592263
MIRT460128	hsa-miR-7851-3p	PAR-CLIP	23592263
MIRT460127	hsa-miR-5694	PAR-CLIP	23592263
MIRT460126	hsa-miR-3192-5p	PAR-CLIP	23592263
MIRT460125	hsa-miR-1273f	PAR-CLIP	23592263
MIRT460124	hsa-miR-4537	PAR-CLIP	23592263
MIRT460123	hsa-miR-6499-3p	PAR-CLIP	23592263
MIRT460122	hsa-miR-6878-5p	PAR-CLIP	23592263
MIRT460121	hsa-miR-6731-5p	PAR-CLIP	23592263
MIRT460120	hsa-miR-8085	PAR-CLIP	23592263
MIRT460119	hsa-miR-6835-5p	PAR-CLIP	23592263
MIRT460118	hsa-miR-6752-5p	PAR-CLIP	23592263
MIRT460117	hsa-miR-6842-5p	PAR-CLIP	23592263
MIRT460116	hsa-miR-7110-5p	PAR-CLIP	23592263
MIRT460115	hsa-miR-455-3p	PAR-CLIP	23592263
MIRT460114	hsa-miR-30c-1-3p	PAR-CLIP	23592263
MIRT460113	hsa-miR-30c-2-3p	PAR-CLIP	23592263
MIRT460112	hsa-miR-6788-5p	PAR-CLIP	23592263
MIRT460111	hsa-miR-6751-5p	PAR-CLIP	23592263
MIRT460110	hsa-miR-6803-5p	PAR-CLIP	23592263
MIRT460109	hsa-miR-6516-5p	PAR-CLIP	23592263
MIRT460108	hsa-miR-6870-5p	PAR-CLIP	23592263
MIRT917952	hsa-miR-100	CLIP-seq
MIRT917953	hsa-miR-1226	CLIP-seq
MIRT917954	hsa-miR-1254	CLIP-seq
MIRT917955	hsa-miR-1255a	CLIP-seq
MIRT917956	hsa-miR-1255b	CLIP-seq
MIRT917957	hsa-miR-1275	CLIP-seq
MIRT917958	hsa-miR-128	CLIP-seq
MIRT917959	hsa-miR-1286	CLIP-seq
MIRT917960	hsa-miR-1293	CLIP-seq
MIRT917961	hsa-miR-1323	CLIP-seq
MIRT917962	hsa-miR-1827	CLIP-seq
MIRT917963	hsa-miR-185	CLIP-seq
MIRT917964	hsa-miR-199a-5p	CLIP-seq
MIRT917965	hsa-miR-199b-5p	CLIP-seq
MIRT917966	hsa-miR-2114	CLIP-seq
MIRT917967	hsa-miR-27a	CLIP-seq
MIRT917968	hsa-miR-27b	CLIP-seq
MIRT917969	hsa-miR-3116	CLIP-seq
MIRT917970	hsa-miR-3130-5p	CLIP-seq
MIRT917971	hsa-miR-3150b-3p	CLIP-seq
MIRT917972	hsa-miR-3184	CLIP-seq
MIRT917973	hsa-miR-3192	CLIP-seq
MIRT917974	hsa-miR-3199	CLIP-seq
MIRT917975	hsa-miR-323-5p	CLIP-seq
MIRT917976	hsa-miR-330-3p	CLIP-seq
MIRT917977	hsa-miR-3605-5p	CLIP-seq
MIRT917978	hsa-miR-3612	CLIP-seq
MIRT917979	hsa-miR-3613-3p	CLIP-seq
MIRT917980	hsa-miR-3646	CLIP-seq
MIRT917981	hsa-miR-3657	CLIP-seq
MIRT917982	hsa-miR-3662	CLIP-seq
MIRT917983	hsa-miR-3663-3p	CLIP-seq
MIRT917984	hsa-miR-3664-3p	CLIP-seq
MIRT917985	hsa-miR-3689a-3p	CLIP-seq
MIRT917986	hsa-miR-3689c	CLIP-seq
MIRT917987	hsa-miR-3689d	CLIP-seq
MIRT917988	hsa-miR-3691-3p	CLIP-seq
MIRT917989	hsa-miR-371-5p	CLIP-seq
MIRT917990	hsa-miR-371b-5p	CLIP-seq
MIRT917991	hsa-miR-383	CLIP-seq
MIRT917992	hsa-miR-3928	CLIP-seq
MIRT917993	hsa-miR-423-5p	CLIP-seq
MIRT917994	hsa-miR-4302	CLIP-seq
MIRT917995	hsa-miR-4306	CLIP-seq
MIRT917996	hsa-miR-4433	CLIP-seq
MIRT917997	hsa-miR-4446-3p	CLIP-seq
MIRT917998	hsa-miR-4447	CLIP-seq
MIRT917999	hsa-miR-4455	CLIP-seq
MIRT918000	hsa-miR-4459	CLIP-seq
MIRT918001	hsa-miR-4472	CLIP-seq
MIRT918002	hsa-miR-4475	CLIP-seq
MIRT918003	hsa-miR-4482	CLIP-seq
MIRT918004	hsa-miR-4483	CLIP-seq
MIRT918005	hsa-miR-4494	CLIP-seq
MIRT918006	hsa-miR-451	CLIP-seq
MIRT918007	hsa-miR-4525	CLIP-seq
MIRT918008	hsa-miR-4644	CLIP-seq
MIRT918009	hsa-miR-4649-3p	CLIP-seq
MIRT918010	hsa-miR-4656	CLIP-seq
MIRT918011	hsa-miR-4665-5p	CLIP-seq
MIRT918012	hsa-miR-4689	CLIP-seq
MIRT918013	hsa-miR-4695-5p	CLIP-seq
MIRT918014	hsa-miR-4710	CLIP-seq
MIRT918015	hsa-miR-4721	CLIP-seq
MIRT918016	hsa-miR-4722-5p	CLIP-seq
MIRT918017	hsa-miR-4723-5p	CLIP-seq
MIRT918018	hsa-miR-4728-5p	CLIP-seq
MIRT918019	hsa-miR-4733-3p	CLIP-seq
MIRT918020	hsa-miR-4740-5p	CLIP-seq
MIRT918021	hsa-miR-4768-3p	CLIP-seq
MIRT918022	hsa-miR-4784	CLIP-seq
MIRT918023	hsa-miR-4786-3p	CLIP-seq
MIRT918024	hsa-miR-4786-5p	CLIP-seq
MIRT918025	hsa-miR-4792	CLIP-seq
MIRT918026	hsa-miR-4795-3p	CLIP-seq
MIRT918027	hsa-miR-499a-5p	CLIP-seq
MIRT918028	hsa-miR-505	CLIP-seq
MIRT918029	hsa-miR-508-5p	CLIP-seq
MIRT918030	hsa-miR-510	CLIP-seq
MIRT918031	hsa-miR-512-5p	CLIP-seq
MIRT918032	hsa-miR-541	CLIP-seq
MIRT918033	hsa-miR-545	CLIP-seq
MIRT918034	hsa-miR-548o	CLIP-seq
MIRT918035	hsa-miR-548p	CLIP-seq
MIRT918036	hsa-miR-582-3p	CLIP-seq
MIRT918037	hsa-miR-587	CLIP-seq
MIRT918038	hsa-miR-625	CLIP-seq
MIRT918039	hsa-miR-650	CLIP-seq
MIRT918040	hsa-miR-654-5p	CLIP-seq
MIRT918041	hsa-miR-661	CLIP-seq
MIRT918042	hsa-miR-765	CLIP-seq
MIRT918043	hsa-miR-766	CLIP-seq
MIRT918044	hsa-miR-876-3p	CLIP-seq
MIRT918045	hsa-miR-940	CLIP-seq
MIRT918046	hsa-miR-99a	CLIP-seq
MIRT918047	hsa-miR-99b	CLIP-seq
MIRT917958	hsa-miR-128	CLIP-seq
MIRT1972107	hsa-miR-1285	CLIP-seq
MIRT917967	hsa-miR-27a	CLIP-seq
MIRT917968	hsa-miR-27b	CLIP-seq
MIRT1972108	hsa-miR-3122	CLIP-seq
MIRT1972109	hsa-miR-3173-3p	CLIP-seq
MIRT1972110	hsa-miR-3187-5p	CLIP-seq
MIRT917973	hsa-miR-3192	CLIP-seq
MIRT917984	hsa-miR-3664-3p	CLIP-seq
MIRT917985	hsa-miR-3689a-3p	CLIP-seq
MIRT917986	hsa-miR-3689c	CLIP-seq
MIRT1972111	hsa-miR-376c	CLIP-seq
MIRT917991	hsa-miR-383	CLIP-seq
MIRT1972112	hsa-miR-3913-5p	CLIP-seq
MIRT1972113	hsa-miR-4428	CLIP-seq
MIRT917996	hsa-miR-4433	CLIP-seq
MIRT917997	hsa-miR-4446-3p	CLIP-seq
MIRT918000	hsa-miR-4459	CLIP-seq
MIRT918005	hsa-miR-4494	CLIP-seq
MIRT1972114	hsa-miR-4521	CLIP-seq
MIRT1972115	hsa-miR-4639-5p	CLIP-seq
MIRT918018	hsa-miR-4728-5p	CLIP-seq
MIRT918021	hsa-miR-4768-3p	CLIP-seq
MIRT1972116	hsa-miR-4779	CLIP-seq
MIRT918024	hsa-miR-4786-5p	CLIP-seq
MIRT918027	hsa-miR-499a-5p	CLIP-seq
MIRT918028	hsa-miR-505	CLIP-seq
MIRT918030	hsa-miR-510	CLIP-seq
MIRT918037	hsa-miR-587	CLIP-seq
MIRT1972117	hsa-miR-612	CLIP-seq
MIRT918041	hsa-miR-661	CLIP-seq
MIRT2207923	hsa-miR-1228	CLIP-seq
MIRT917958	hsa-miR-128	CLIP-seq
MIRT917960	hsa-miR-1293	CLIP-seq
MIRT917967	hsa-miR-27a	CLIP-seq
MIRT917968	hsa-miR-27b	CLIP-seq
MIRT1972108	hsa-miR-3122	CLIP-seq
MIRT917973	hsa-miR-3192	CLIP-seq
MIRT2207924	hsa-miR-342-3p	CLIP-seq
MIRT917985	hsa-miR-3689a-3p	CLIP-seq
MIRT917986	hsa-miR-3689c	CLIP-seq
MIRT1972112	hsa-miR-3913-5p	CLIP-seq
MIRT2207925	hsa-miR-4252	CLIP-seq
MIRT2207926	hsa-miR-4284	CLIP-seq
MIRT917997	hsa-miR-4446-3p	CLIP-seq
MIRT918004	hsa-miR-4483	CLIP-seq
MIRT918018	hsa-miR-4728-5p	CLIP-seq
MIRT918032	hsa-miR-541	CLIP-seq
MIRT918040	hsa-miR-654-5p	CLIP-seq
MIRT918041	hsa-miR-661	CLIP-seq
MIRT2447846	hsa-miR-186	CLIP-seq
MIRT2447847	hsa-miR-3133	CLIP-seq
MIRT917975	hsa-miR-323-5p	CLIP-seq
MIRT917979	hsa-miR-3613-3p	CLIP-seq
MIRT917983	hsa-miR-3663-3p	CLIP-seq
MIRT2447848	hsa-miR-4432	CLIP-seq
MIRT917999	hsa-miR-4455	CLIP-seq
MIRT2447849	hsa-miR-4684-5p	CLIP-seq
MIRT918014	hsa-miR-4710	CLIP-seq
MIRT918025	hsa-miR-4792	CLIP-seq
MIRT2447850	hsa-miR-548c-3p	CLIP-seq
MIRT918037	hsa-miR-587	CLIP-seq
MIRT918041	hsa-miR-661	CLIP-seq
MIRT918044	hsa-miR-876-3p	CLIP-seq
MIRT2447846	hsa-miR-186	CLIP-seq
MIRT2447847	hsa-miR-3133	CLIP-seq
MIRT2447848	hsa-miR-4432	CLIP-seq
MIRT918037	hsa-miR-587	CLIP-seq
MIRT2207923	hsa-miR-1228	CLIP-seq
MIRT917954	hsa-miR-1254	CLIP-seq
MIRT917955	hsa-miR-1255a	CLIP-seq
MIRT917956	hsa-miR-1255b	CLIP-seq
MIRT917960	hsa-miR-1293	CLIP-seq
MIRT917969	hsa-miR-3116	CLIP-seq
MIRT1972108	hsa-miR-3122	CLIP-seq
MIRT917975	hsa-miR-323-5p	CLIP-seq
MIRT917979	hsa-miR-3613-3p	CLIP-seq
MIRT917983	hsa-miR-3663-3p	CLIP-seq
MIRT917985	hsa-miR-3689a-3p	CLIP-seq
MIRT917986	hsa-miR-3689c	CLIP-seq
MIRT1972112	hsa-miR-3913-5p	CLIP-seq
MIRT2207925	hsa-miR-4252	CLIP-seq
MIRT917996	hsa-miR-4433	CLIP-seq
MIRT917999	hsa-miR-4455	CLIP-seq
MIRT918000	hsa-miR-4459	CLIP-seq
MIRT918004	hsa-miR-4483	CLIP-seq
MIRT2447849	hsa-miR-4684-5p	CLIP-seq
MIRT918014	hsa-miR-4710	CLIP-seq
MIRT918018	hsa-miR-4728-5p	CLIP-seq
MIRT918021	hsa-miR-4768-3p	CLIP-seq
MIRT918024	hsa-miR-4786-5p	CLIP-seq
MIRT918025	hsa-miR-4792	CLIP-seq
MIRT2511254	hsa-miR-4793-3p	CLIP-seq
MIRT918028	hsa-miR-505	CLIP-seq
MIRT918029	hsa-miR-508-5p	CLIP-seq
MIRT918032	hsa-miR-541	CLIP-seq
MIRT2447850	hsa-miR-548c-3p	CLIP-seq
MIRT918040	hsa-miR-654-5p	CLIP-seq
MIRT918041	hsa-miR-661	CLIP-seq
MIRT918043	hsa-miR-766	CLIP-seq
MIRT918044	hsa-miR-876-3p	CLIP-seq
MIRT917975	hsa-miR-323-5p	CLIP-seq
MIRT917979	hsa-miR-3613-3p	CLIP-seq
MIRT917983	hsa-miR-3663-3p	CLIP-seq
MIRT917999	hsa-miR-4455	CLIP-seq
MIRT2447849	hsa-miR-4684-5p	CLIP-seq
MIRT918014	hsa-miR-4710	CLIP-seq
MIRT918025	hsa-miR-4792	CLIP-seq
MIRT2447850	hsa-miR-548c-3p	CLIP-seq
MIRT918044	hsa-miR-876-3p	CLIP-seq

Show/Hide all (38)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005041	Function	Low-density lipoprotein particle receptor activity	IBA
GO:0005041	Function	Low-density lipoprotein particle receptor activity	IEA
GO:0005041	Function	Low-density lipoprotein particle receptor activity	ISS
GO:0005044	Function	Scavenger receptor activity	IBA
GO:0005044	Function	Scavenger receptor activity	IEA
GO:0005044	Function	Scavenger receptor activity	TAS	11060282
GO:0005125	Function	Cytokine activity	IEA
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IDA	18373975
GO:0005615	Component	Extracellular space	IEA
GO:0005886	Component	Plasma membrane	IEA
GO:0006898	Process	Receptor-mediated endocytosis	IEA
GO:0006898	Process	Receptor-mediated endocytosis	NAS	11060282
GO:0006935	Process	Chemotaxis	IEA
GO:0006935	Process	Chemotaxis	NAS	11290797
GO:0007165	Process	Signal transduction	IEA
GO:0008009	Function	Chemokine activity	IBA
GO:0008009	Function	Chemokine activity	IDA	18373975
GO:0008009	Function	Chemokine activity	IEA
GO:0008009	Function	Chemokine activity	ISS
GO:0010818	Process	T cell chemotaxis	IBA
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	NAS	11290797
GO:0016020	Component	Membrane	TAS	11060282
GO:0030307	Process	Positive regulation of cell growth	IEA
GO:0030307	Process	Positive regulation of cell growth	IMP	18373975
GO:0030335	Process	Positive regulation of cell migration	IBA
GO:0030335	Process	Positive regulation of cell migration	IEA
GO:0030335	Process	Positive regulation of cell migration	IMP	18373975
GO:0034097	Process	Response to cytokine	IDA	18373975
GO:0034097	Process	Response to cytokine	IEA
GO:0034341	Process	Response to type II interferon	IDA	18373975
GO:0034341	Process	Response to type II interferon	IEA
GO:0034612	Process	Response to tumor necrosis factor	IDA	18373975
GO:0034612	Process	Response to tumor necrosis factor	IEA
GO:0048247	Process	Lymphocyte chemotaxis	IEA

MIM	HGNC	e!Ensembl
605398	16642	ENSG00000161921

Q9H2A7

Protein name

C-X-C motif chemokine 16 (Scavenger receptor for phosphatidylserine and oxidized low density lipoprotein) (SR-PSOX) (Small-inducible cytokine B16) (Transmembrane chemokine CXCL16)

Protein function

Acts as a scavenger receptor on macrophages, which specifically binds to OxLDL (oxidized low density lipoprotein), suggesting that it may be involved in pathophysiology such as atherogenesis (By similarity). Induces a strong chemotactic response

Family and domains

Tissue specificity

TISSUE SPECIFICITY: Expressed in T-cell areas. Expressed in spleen, lymph nodes, lung, kidney, small intestine and thymus. Weak expression in heart and liver and no expression in brain and bone marrow.

Sequence

MGRDLRPGSRVLLLLLLLLLVYLTQPGNGNEGSVTGSCYCGKRISSDSPPSVQFMNRLRK
HLRAYHRCLYYTRFQLLSWSVCGGNKDPWVQELMSCLDLKECGHAYSGIVAHQKHLLPTS
PPISQASEGASSDIHTPAQMLLSTLQSTQRPTLPVGSLSSDKELTRPNETTIHTAGHSLA
AGPEAGENQKQPEKNAGPTARTSATVPVLCLLAIIFILTAALSYVLCKRRRGQSPQSSPD
LPVHYIPVAPDSNT

Sequence length

254

Interactions

View interactions

	KEGG		Reactome
	Cytokine-cytokine receptor interaction Chemokine signaling pathway		Chemokine receptors bind chemokines G alpha (i) signalling events

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (2)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
LIVER CIRRHOSIS, EXPERIMENTAL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (208)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Acute Coronary Syndrome	Coronary Syndrome	BEFREE	18272035, 31554419		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute Coronary Syndrome	Coronary Syndrome	LHGDN	18279707, 18514099		★★★★★ ★☆☆☆☆ Found in Text Mining only
Acute pancreatitis	Pancreatitis	BEFREE	29891873		★★★★★ ★☆☆☆☆ Found in Text Mining only
Adult Hodgkin Lymphoma	Hodgkin Lymphoma	BEFREE	23743627		★★★★★ ★☆☆☆☆ Found in Text Mining only
Angina, Unstable	Intermediate coronary syndrome	BEFREE	18272035		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Abdominal	Aortic Aneurysm	BEFREE	29800106		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aortic Valve Calcification of	Aortic valve disease	Pubtator	35865542	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	18272035, 19954776, 20621591, 25142184, 26289084, 27877078, 28647282, 30015963, 30071823, 30710793, 31554419		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	23633118		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Psoriatic	Psoriatic arthritis	Pubtator	35055107, 35784287	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	15880344, 24000379, 34271942	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	32365786, 33633196	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis, Psoriatic	Psoriatic Arthritis	BEFREE	31677365		★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	30467418		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	15836657, 17342260, 19494317, 21492481, 25142184, 27877078, 28286356	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	18272035, 19954776, 20621591, 25142184, 26289084, 27877078, 28647282, 30015963, 30071823, 30710793, 31554419		★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	28886489		★★★★★ ★☆☆☆☆ Found in Text Mining only
Benign Prostatic Hyperplasia	Benign Prostatic Hyperplasia	BEFREE	18452560		★★★★★ ★☆☆☆☆ Found in Text Mining only
Blood Platelet Disorders	Platelet disorder	Pubtator	36232370	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Ischemia	Cerebral Ischemia	BEFREE	30542347		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	28698473	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	18713980, 24864132, 30722112, 31698786		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	25909173, 36950218	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	18559516, 22863086, 29285224		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	36938723	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	24897301, 29353287		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	21527066	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	18195710, 28759013	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	30792527		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiomyopathies	Cardiomyopathy	Pubtator	33637127	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	LHGDN	17300746		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	28633141, 29326688, 30688187		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	35784287	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carotid Atherosclerosis	Carotid Atherosclerosis	BEFREE	20621591, 23398954, 25142184		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carotid Stenosis	Carotid artery stenosis	Pubtator	25142184	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cataract	Cataract	Pubtator	32180680	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Central Nervous System Diseases	Central nervous system disease	Pubtator	27344170	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	20621591		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholecystitis	Cholecystitis	LHGDN	17803654		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholecystolithiasis	Cholecystolithiasis	BEFREE	28722105		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cholelithiasis	Cholelithiasis	BEFREE	28722105		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic kidney disease stage 5	Kidney Disease	BEFREE	27877078, 30071823		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	22627199		★★★★★ ★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	29326688		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	31752131		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	36246978	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	17510400, 23242131, 29981574, 31191026		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	17510400, 30847498, 31752131	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	26258407	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Common Variable Immunodeficiency	Common variable immunodeficiency	Pubtator	22454615	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	19919988		★★★★★ ★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	18195710, 19070478		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	15836657, 18339644, 19954776, 21233446, 22927331, 26045830, 29399085		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	15836657, 18339644, 19954776, 21233446, 22927331, 26045830, 29399085		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	15836657, 36232370	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	38357816	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Disease	Coronary artery disease	Pubtator	26045830	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	15836657, 18339644, 19954776, 21233446, 22927331, 26045830, 29399085		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Stenosis	Coronary Stenosis	BEFREE	15836657		★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Stenosis	Coronary stenosis	Pubtator	15836657	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	BEFREE	18248772, 24630488		★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn Disease	LHGDN	18248772		★★★★★ ★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	26621504		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Gestational diabetes	Pubtator	28856928	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	30894181		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	28478039, 29620052, 31598726		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	31033093		★★★★★ ★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	Pubtator	28856928	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	29779473		★★★★★ ★☆☆☆☆ Found in Text Mining only
Eosinophilic Esophagitis	Eosinophilia	Pubtator	24513807	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Epilepsies Myoclonic	Myoclonic epilepsy	Pubtator	27344170	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	30018721, 31002999		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	23596313		★★★★★ ★☆☆☆☆ Found in Text Mining only
Gastric Adenocarcinoma	Gastric Cancer	BEFREE	24911042		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	24859792, 28698473, 30542347		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	28698473, 32346064, 38299146	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	28698473, 30542347		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	23628207, 30542347		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	28698473, 35896732	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glomerulonephritis Membranous	Membranous glomerulonephritis	Pubtator	19435795	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glycogen Storage Disease Type II	Glycogen storage disease	Pubtator	27122966	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Gout	Gout	BEFREE	22627199		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart Defects Congenital	Congenital heart defect	Pubtator	26044615	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	19919988		★★★★★ ★☆☆☆☆ Found in Text Mining only
Heart valve disease	Cardiac valvular disease	LHGDN	14699018		★★★★★ ★☆☆☆☆ Found in Text Mining only
Henoch-Schoenlein Purpura	Henoch-Schonlein Nephritis	BEFREE	21638128		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hepatitis C	Hepatitis c	Pubtator	31652598	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	23743627		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	34011069	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Immune System Diseases	Immune system disease	Pubtator	35865542	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Immune thrombocytopenic purpura	Immune Thrombocytopenic Purpura	BEFREE	28886489		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	18248772		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral disc disease	Pubtator	38044363	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Irritable Bowel Syndrome	Irritable bowel syndrome	Pubtator	24667736	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	28975971, 30945283		★★★★★ ★☆☆☆☆ Found in Text Mining only
Juvenile arthritis	Arthritis	BEFREE	18760678		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	19435795	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure Chronic	Kidney failure	Pubtator	27877078	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	29275176, 30662622		★★★★★ ★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	BEFREE	27877078, 30071823		★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	38172124	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	27216982, 30710528		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	18272035		★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis Biliary	Liver cirrhosis	Pubtator	15634930, 34367180	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Diseases	Liver disease	Pubtator	15634930	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver Failure, Acute	Liver failure	BEFREE	28459937		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Diseases Interstitial	Lung disease	Pubtator	36922030	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Diseases Interstitial	Lung disease	Pubtator	37587067	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Diseases, Interstitial	Lung Diseases	BEFREE	31753588		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	24897301, 29327939, 29353287	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	25888629, 27095254	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	31019506	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	28628472, 30006918, 31019506		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus Nephritis	BEFREE	30006918		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	21527066	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic Metastasis	BEFREE	29353287		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	29353287	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	23743627		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	BEFREE	23743627		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin, Familial	Lymphoma	BEFREE	23743627		★★★★★ ★☆☆☆☆ Found in Text Mining only
Macular Degeneration	Macular degeneration	Pubtator	30894217	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	18713980, 24864132, 30722112, 31698786		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of kidney	Kidney Cancer	BEFREE	19070478		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	24897301, 29353287		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	30792527		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	18344492, 18452560, 19047182, 21468586, 22290877, 26799186		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	28440473		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	31527616		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	15202017, 18344492, 22863086, 23242131, 24864132, 26021984, 27725631, 28267793, 29981574		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Peripheral Nerve Sheath Tumor	Malignant Peripheral Nerve Sheath Tumor	BEFREE	18293410		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	31752131		★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	28698473		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	28698473	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	BEFREE	23229614, 27784296		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	29800106, 30053055		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	35784287	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	35865542	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	29800106		★★★★★ ★☆☆☆☆ Found in Text Mining only
Metastatic Prostate Carcinoma	Metastatic Prostate Carcinoma	BEFREE	18344492		★★★★★ ★☆☆☆☆ Found in Text Mining only
Moyamoya Disease	Moyamoya disease	Pubtator	32617116	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	Pubtator	33082496, 38357816	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	23334594, 24854635		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	28286356, 31554419		★★★★★ ★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	28286356, 33637127	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	22226739	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	BEFREE	26058873		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	19070478, 22710437, 23242131, 24864132, 25712684, 26021984, 29148169, 31191026, 31752131		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nephrotic Syndrome	Nephrotic syndrome	Pubtator	35514316	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurilemmoma	Neurilemmoma	BEFREE	18293410		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	28722105, 30018721, 30053055		★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	25345539, 26021984, 28599467		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nongranulomatous uveitis	Nongranulomatous uveitis	BEFREE	29715366		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	29763838		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	38044363	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Oligoarticular Juvenile Idiopathic Arthritis	Oligoarticular Arthritis	BEFREE	18760678		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	36879307	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	25391425		★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	25391425	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	30792527		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	21527066, 24518602, 25712684, 30792527, 37272931	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	18559516		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasm	Pancreatic Neoplasm	LHGDN	18636150		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pancreatitis	Pancreatitis	BEFREE	29891873		★★★★★ ★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	31527616		★★★★★ ★☆☆☆☆ Found in Text Mining only
Periodontal Diseases	Periodontal Diseases	BEFREE	17459077		★★★★★ ★☆☆☆☆ Found in Text Mining only
Periodontal Diseases	Periodontal disease	Pubtator	17459077	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	18344492, 18452560, 19047182, 21468586, 22290877, 26799186		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Hyperplasia	Prostatic Hyperplasia	BEFREE	21468586		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Hypertrophy	Prostatic Hypertrophy	BEFREE	21468586		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	LHGDN	18344492		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	18344492, 18452560, 19690611, 22958742, 26272362, 26799186, 30974114	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	28942364		★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	Pubtator	28942364, 35784287	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Arterial Hypertension	Pulmonary arterial hypertension	Pubtator	21303517	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	29725270	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	31379980, 31753588		★★★★★ ★☆☆☆☆ Found in Text Mining only
Pyoderma Gangrenosum	Pyoderma gangrenosum	Pubtator	24903614, 25501066	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rectal Carcinoma	Rectal Carcinoma	BEFREE	15202017		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal carcinoma	Renal Carcinoma	BEFREE	19070478		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	18195710, 19070478		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal fibrosis	Renal fibrosis	BEFREE	25572934		★★★★★ ★☆☆☆☆ Found in Text Mining only
Renal Insufficiency	Renal Insufficiency	BEFREE	28478039		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rhabdomyosarcoma	Rhabdomyosarcoma	BEFREE	22525722		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	LHGDN	16200580, 17300746		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	23633118, 26135838, 26621504		★★★★★ ★☆☆☆☆ Found in Text Mining only
Sarcoidosis	Sarcoidosis	BEFREE	29715366		★★★★★ ★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	30688187		★★★★★ ★☆☆☆☆ Found in Text Mining only
Scleroderma Systemic	Systemic sclerosis	Pubtator	21303517, 37587067	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Somatotrophinoma, Familial	Somatotroph adenoma	BEFREE	28921877		★★★★★ ★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	39815613	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	29956205, 30053055, 31002999		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	28440473		★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	26708384, 35261108	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Sweet Syndrome	Sweet syndrome	Pubtator	24903614	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thrombosis	Thrombosis	Pubtator	36232370	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	31527616		★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	31527616		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	27725631		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	36950218	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	24630488		★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	34517533	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Dysplasia	Uterine disease	Pubtator	22958742	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	22958742	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Uveitis	Uveitis	BEFREE	29715366		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	LHGDN	14625285		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vitiligo	Vitiligo	BEFREE	27826097, 30998983		★★★★★ ★☆☆☆☆ Found in Text Mining only
Vitiligo	Vitiligo	Pubtator	27826097, 32532953	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
VITILIGO-ASSOCIATED MULTIPLE AUTOIMMUNE DISEASE SUSCEPTIBILITY 1 (finding)	Vitiligo-associated SYSTEMIC LUPUS ERYTHEMATOSUS	BEFREE	27826097, 30998983		★★★★★ ★☆☆☆☆ Found in Text Mining only

CXCL16 (C-X-C motif chemokine ligand 16)