Gene Gene information from NCBI Gene database.
Entrez ID 58191
Gene name C-X-C motif chemokine ligand 16
Gene symbol CXCL16
Synonyms (NCBI Gene)
CXCLG16SR-PSOXSRPSOX
Chromosome 17
Chromosome location 17p13.2
miRNA miRNA information provided by mirtarbase database.
253
miRTarBase ID miRNA Experiments Reference
MIRT019098 hsa-miR-335-5p Microarray 18185580
MIRT049831 hsa-miR-92a-3p CLASH 23622248
MIRT037621 hsa-miR-744-5p CLASH 23622248
MIRT460129 hsa-miR-490-3p PAR-CLIP 23592263
MIRT460128 hsa-miR-7851-3p PAR-CLIP 23592263
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
38
GO ID Ontology Definition Evidence Reference
GO:0005041 Function Low-density lipoprotein particle receptor activity IBA
GO:0005041 Function Low-density lipoprotein particle receptor activity IEA
GO:0005041 Function Low-density lipoprotein particle receptor activity ISS
GO:0005044 Function Scavenger receptor activity IBA
GO:0005044 Function Scavenger receptor activity IEA
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
605398 16642 ENSG00000161921
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q9H2A7
Protein name C-X-C motif chemokine 16 (Scavenger receptor for phosphatidylserine and oxidized low density lipoprotein) (SR-PSOX) (Small-inducible cytokine B16) (Transmembrane chemokine CXCL16)
Protein function Acts as a scavenger receptor on macrophages, which specifically binds to OxLDL (oxidized low density lipoprotein), suggesting that it may be involved in pathophysiology such as atherogenesis (By similarity). Induces a strong chemotactic response
Family and domains
Tissue specificity TISSUE SPECIFICITY: Expressed in T-cell areas. Expressed in spleen, lymph nodes, lung, kidney, small intestine and thymus. Weak expression in heart and liver and no expression in brain and bone marrow.
Sequence
MGRDLRPGSRVLLLLLLLLLVYLTQPGNGNEGSVTGSCYCGKRISSDSPPSVQFMNRLRK
HLRAYHRCLYYTRFQLLSWSVCGGNKDPWVQELMSCLDLKECGHAYSGIVAHQKHLLPTS
PPISQASEGASSDIHTPAQMLLSTLQSTQRPTLPVGSLSSDKELTRPNETTIHTAGHSLA
AGPEAGENQKQPEKNAGPTARTSATVPVLCLLAIIFILTAALSYVLCKRRRGQSPQSSPD
LPVHYIPVAPDSNT
Sequence length 254
Interactions View interactions
Pathways Pathway information has different metabolic/signaling pathways associated with genes.
  KEGG  Reactome
  Cytokine-cytokine receptor interaction
Chemokine signaling pathway
  Chemokine receptors bind chemokines
G alpha (i) signalling events
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
2
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
LIVER CIRRHOSIS, EXPERIMENTAL CTD
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Sarcoma Benign ClinVar
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Acute Coronary Syndrome Coronary Syndrome BEFREE 18272035, 31554419
★☆☆☆☆
Found in Text Mining only
Acute Coronary Syndrome Coronary Syndrome LHGDN 18279707, 18514099
★☆☆☆☆
Found in Text Mining only
Acute pancreatitis Pancreatitis BEFREE 29891873
★☆☆☆☆
Found in Text Mining only
Adult Hodgkin Lymphoma Hodgkin Lymphoma BEFREE 23743627
★☆☆☆☆
Found in Text Mining only
Angina, Unstable Intermediate coronary syndrome BEFREE 18272035
★☆☆☆☆
Found in Text Mining only
Aortic Aneurysm, Abdominal Aortic Aneurysm BEFREE 29800106
★☆☆☆☆
Found in Text Mining only
Aortic Valve Calcification of Aortic valve disease Pubtator 35865542 Associate
★☆☆☆☆
Found in Text Mining only
Arteriosclerosis Arteriosclerosis BEFREE 18272035, 19954776, 20621591, 25142184, 26289084, 27877078, 28647282, 30015963, 30071823, 30710793, 31554419
★☆☆☆☆
Found in Text Mining only
Arthritis Arthritis BEFREE 23633118
★☆☆☆☆
Found in Text Mining only
Arthritis Psoriatic Psoriatic arthritis Pubtator 35055107, 35784287 Associate
★☆☆☆☆
Found in Text Mining only