WFDC1 (WAP four-disulfide core domain 1)

Gene

• Entrez ID: 58189
• Gene name: WAP four-disulfide core domain 1
• Gene symbol: WFDC1
• Synonyms (NCBI Gene): PS20
• Chromosome: 16
• Chromosome location: 16q24.1
• Summary: This gene encodes a member of the WAP-type four disulfide core domain family. The WAP-type four-disulfide core domain contains eight cysteines forming four disulfide bonds at the core of the protein, and functions as a protease inhibitor in many family me

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT1492337	hsa-miR-3926	CLIP-seq
MIRT1492338	hsa-miR-4505	CLIP-seq
MIRT1492339	hsa-miR-4640-5p	CLIP-seq
MIRT1492340	hsa-miR-4726-5p	CLIP-seq
MIRT2368867	hsa-miR-558	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001558	Process	Regulation of cell growth	IBA
GO:0004867	Function	Serine-type endopeptidase inhibitor activity	IEA
GO:0005576	Component	Extracellular region	IEA
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	NAS	10967136
GO:0030308	Process	Negative regulation of cell growth	NAS	10967136
GO:0030414	Function	Peptidase inhibitor activity	IEA
GO:0050728	Process	Negative regulation of inflammatory response	IEA
GO:0061045	Process	Negative regulation of wound healing	IEA

Other IDs

• MIM: 605322
• HGNC: 15466
• e!Ensembl: ENSG00000103175

Protein

• UniProt ID: Q9HC57
• Protein name: WAP four-disulfide core domain protein 1 (Prostate stromal protein ps20) (ps20 growth inhibitor)
• Protein function: Has growth inhibitory activity.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00095	WAP	62 → 107		Domain

• Sequence:

  MPLTGVGPGSCRRQIIRALCLLLLLLHAGSAKNIWKRALPARLAEKSRAEEAGAPGGPRQ
  PRADRCPPPPRTLPPGACQAARCQADSECPRHRRCCYNGCAYACLEAVPPPPVLDWLVQP
  KPRWLGGNGWLLDGPEEVLQAEACSTTEDGAEPLLCPSGYECHILSPGDVAEGIPNRGQC
  VKQRRQADGRILRHKLYKEYPEGDSKNVAEPGRGQQKHFQ

• Sequence length: 220

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
MELANOMA	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSYCHIATRIC DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STROKE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	20090771	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	18842679	Associate	★☆☆☆☆ Found in Text Mining only
Duane Retraction Syndrome	Duane Retraction Syndrome	BEFREE	14522910		★☆☆☆☆ Found in Text Mining only
Fibrosarcoma	Fibrosarcoma	BEFREE	18842679		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	12032731		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	UNIPROT_DG			★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	14522910, 15305342, 27115470, 30423385		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	10967136, 29548303		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	CTD_human_DG	17145863		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
melanoma	Melanoma	BEFREE	19488830		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neoplasms	Neoplasms	BEFREE	12032731, 14522910, 15305342, 18842679, 19488830, 27115470		★☆☆☆☆ Found in Text Mining only
Nephroblastoma	Nephroblastoma	BEFREE	10967136		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	14522910, 15305342, 27115470, 30423385		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	15305342		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	27115470	Inhibit	★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	18842679	Inhibit	★☆☆☆☆ Found in Text Mining only