PVR (PVR cell adhesion molecule)

Gene

• Entrez ID: 5817
• Gene name: PVR cell adhesion molecule
• Gene symbol: PVR
• Synonyms (NCBI Gene): CD155, HVED, NECL5, Necl-5, PVS, TAGE4
• Chromosome: 19
• Chromosome location: 19q13.31
• Summary: The protein encoded by this gene is a transmembrane glycoprotein belonging to the immunoglobulin superfamily. The external domain mediates cell attachment to the extracellular matrix molecule vitronectin, while its intracellular domain interacts with the

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT031973	hsa-miR-16-5p	Proteomics	18668040
MIRT032490	hsa-let-7b-5p	Proteomics	18668040
MIRT040310	hsa-miR-615-3p	CLASH	23622248
MIRT690855	hsa-miR-339-5p	HITS-CLIP	23313552
MIRT690854	hsa-miR-4421	HITS-CLIP	23313552
MIRT690853	hsa-miR-5699-3p	HITS-CLIP	23313552
MIRT690852	hsa-miR-4769-3p	HITS-CLIP	23313552
MIRT690851	hsa-miR-6817-5p	HITS-CLIP	23313552
MIRT690850	hsa-miR-4725-5p	HITS-CLIP	23313552
MIRT690849	hsa-miR-5189-3p	HITS-CLIP	23313552
MIRT690848	hsa-miR-346	HITS-CLIP	23313552
MIRT690847	hsa-miR-513c-5p	HITS-CLIP	23313552
MIRT690846	hsa-miR-514b-5p	HITS-CLIP	23313552
MIRT690845	hsa-miR-4727-5p	HITS-CLIP	23313552
MIRT550243	hsa-miR-3609	PAR-CLIP	20371350
MIRT550242	hsa-miR-548ah-5p	PAR-CLIP	20371350
MIRT293647	hsa-miR-106a-5p	PAR-CLIP	20371350
MIRT293649	hsa-miR-106b-5p	PAR-CLIP	20371350
MIRT293644	hsa-miR-17-5p	PAR-CLIP	20371350
MIRT293645	hsa-miR-20a-5p	PAR-CLIP	20371350
MIRT293650	hsa-miR-20b-5p	PAR-CLIP	20371350
MIRT293654	hsa-miR-519d-3p	PAR-CLIP	20371350
MIRT293652	hsa-miR-526b-3p	PAR-CLIP	20371350
MIRT293646	hsa-miR-93-5p	PAR-CLIP	20371350
MIRT550241	hsa-miR-4796-3p	PAR-CLIP	20371350
MIRT563072	hsa-miR-5692a	PAR-CLIP	20371350
MIRT550240	hsa-miR-7-1-3p	PAR-CLIP	20371350
MIRT550239	hsa-miR-7-2-3p	PAR-CLIP	20371350
MIRT293655	hsa-miR-519a-3p	PAR-CLIP	20371350
MIRT293653	hsa-miR-519b-3p	PAR-CLIP	20371350
MIRT293651	hsa-miR-519c-3p	PAR-CLIP	20371350
MIRT293648	hsa-miR-142-5p	PAR-CLIP	20371350
MIRT293656	hsa-miR-5590-3p	PAR-CLIP	20371350
MIRT082458	hsa-miR-4272	PAR-CLIP	20371350
MIRT550250	hsa-miR-3160-3p	PAR-CLIP	21572407
MIRT550249	hsa-miR-558	PAR-CLIP	21572407
MIRT293606	hsa-miR-3171	PAR-CLIP	21572407
MIRT293607	hsa-miR-1193	PAR-CLIP	21572407
MIRT550247	hsa-miR-4792	PAR-CLIP	21572407
MIRT550248	hsa-miR-4710	PAR-CLIP	21572407
MIRT550246	hsa-miR-376b-5p	PAR-CLIP	21572407
MIRT550245	hsa-miR-376c-5p	PAR-CLIP	21572407
MIRT293608	hsa-miR-3691-5p	PAR-CLIP	21572407
MIRT550244	hsa-miR-8056	PAR-CLIP	21572407
MIRT293609	hsa-miR-3911	PAR-CLIP	21572407
MIRT293605	hsa-miR-432-3p	PAR-CLIP	21572407
MIRT293612	hsa-miR-7855-5p	PAR-CLIP	21572407
MIRT293610	hsa-miR-4752	PAR-CLIP	21572407
MIRT550243	hsa-miR-3609	PAR-CLIP	21572407
MIRT550242	hsa-miR-548ah-5p	PAR-CLIP	21572407
MIRT293647	hsa-miR-106a-5p	PAR-CLIP	21572407
MIRT293649	hsa-miR-106b-5p	PAR-CLIP	21572407
MIRT293644	hsa-miR-17-5p	PAR-CLIP	21572407
MIRT293645	hsa-miR-20a-5p	PAR-CLIP	21572407
MIRT293650	hsa-miR-20b-5p	PAR-CLIP	21572407
MIRT293654	hsa-miR-519d-3p	PAR-CLIP	21572407
MIRT293652	hsa-miR-526b-3p	PAR-CLIP	21572407
MIRT293646	hsa-miR-93-5p	PAR-CLIP	21572407
MIRT550241	hsa-miR-4796-3p	PAR-CLIP	21572407
MIRT550240	hsa-miR-7-1-3p	PAR-CLIP	21572407
MIRT550239	hsa-miR-7-2-3p	PAR-CLIP	21572407
MIRT293655	hsa-miR-519a-3p	PAR-CLIP	21572407
MIRT293653	hsa-miR-519b-3p	PAR-CLIP	21572407
MIRT293651	hsa-miR-519c-3p	PAR-CLIP	21572407
MIRT293648	hsa-miR-142-5p	PAR-CLIP	21572407
MIRT293656	hsa-miR-5590-3p	PAR-CLIP	21572407
MIRT082458	hsa-miR-4272	PAR-CLIP	21572407
MIRT690855	hsa-miR-339-5p	HITS-CLIP	23313552
MIRT690854	hsa-miR-4421	HITS-CLIP	23313552
MIRT690853	hsa-miR-5699-3p	HITS-CLIP	23313552
MIRT690852	hsa-miR-4769-3p	HITS-CLIP	23313552
MIRT690851	hsa-miR-6817-5p	HITS-CLIP	23313552
MIRT690850	hsa-miR-4725-5p	HITS-CLIP	23313552
MIRT690849	hsa-miR-5189-3p	HITS-CLIP	23313552
MIRT690848	hsa-miR-346	HITS-CLIP	23313552
MIRT690847	hsa-miR-513c-5p	HITS-CLIP	23313552
MIRT690846	hsa-miR-514b-5p	HITS-CLIP	23313552
MIRT690845	hsa-miR-4727-5p	HITS-CLIP	23313552
MIRT550243	hsa-miR-3609	PAR-CLIP	20371350
MIRT550242	hsa-miR-548ah-5p	PAR-CLIP	20371350
MIRT293647	hsa-miR-106a-5p	PAR-CLIP	20371350
MIRT293649	hsa-miR-106b-5p	PAR-CLIP	20371350
MIRT293644	hsa-miR-17-5p	PAR-CLIP	20371350
MIRT293645	hsa-miR-20a-5p	PAR-CLIP	20371350
MIRT293650	hsa-miR-20b-5p	PAR-CLIP	20371350
MIRT293654	hsa-miR-519d-3p	PAR-CLIP	20371350
MIRT293652	hsa-miR-526b-3p	PAR-CLIP	20371350
MIRT293646	hsa-miR-93-5p	PAR-CLIP	20371350
MIRT550241	hsa-miR-4796-3p	PAR-CLIP	20371350
MIRT563072	hsa-miR-5692a	PAR-CLIP	20371350
MIRT550240	hsa-miR-7-1-3p	PAR-CLIP	20371350
MIRT550239	hsa-miR-7-2-3p	PAR-CLIP	20371350
MIRT293655	hsa-miR-519a-3p	PAR-CLIP	20371350
MIRT293653	hsa-miR-519b-3p	PAR-CLIP	20371350
MIRT293651	hsa-miR-519c-3p	PAR-CLIP	20371350
MIRT293648	hsa-miR-142-5p	PAR-CLIP	20371350
MIRT293656	hsa-miR-5590-3p	PAR-CLIP	20371350
MIRT082458	hsa-miR-4272	PAR-CLIP	20371350
MIRT550250	hsa-miR-3160-3p	PAR-CLIP	21572407
MIRT550249	hsa-miR-558	PAR-CLIP	21572407
MIRT293606	hsa-miR-3171	PAR-CLIP	21572407
MIRT293607	hsa-miR-1193	PAR-CLIP	21572407
MIRT550247	hsa-miR-4792	PAR-CLIP	21572407
MIRT550248	hsa-miR-4710	PAR-CLIP	21572407
MIRT550246	hsa-miR-376b-5p	PAR-CLIP	21572407
MIRT550245	hsa-miR-376c-5p	PAR-CLIP	21572407
MIRT293608	hsa-miR-3691-5p	PAR-CLIP	21572407
MIRT550244	hsa-miR-8056	PAR-CLIP	21572407
MIRT293609	hsa-miR-3911	PAR-CLIP	21572407
MIRT293605	hsa-miR-432-3p	PAR-CLIP	21572407
MIRT293612	hsa-miR-7855-5p	PAR-CLIP	21572407
MIRT293610	hsa-miR-4752	PAR-CLIP	21572407
MIRT550243	hsa-miR-3609	PAR-CLIP	21572407
MIRT550242	hsa-miR-548ah-5p	PAR-CLIP	21572407
MIRT293647	hsa-miR-106a-5p	PAR-CLIP	21572407
MIRT293649	hsa-miR-106b-5p	PAR-CLIP	21572407
MIRT293644	hsa-miR-17-5p	PAR-CLIP	21572407
MIRT293645	hsa-miR-20a-5p	PAR-CLIP	21572407
MIRT293650	hsa-miR-20b-5p	PAR-CLIP	21572407
MIRT293654	hsa-miR-519d-3p	PAR-CLIP	21572407
MIRT293652	hsa-miR-526b-3p	PAR-CLIP	21572407
MIRT293646	hsa-miR-93-5p	PAR-CLIP	21572407
MIRT550241	hsa-miR-4796-3p	PAR-CLIP	21572407
MIRT550240	hsa-miR-7-1-3p	PAR-CLIP	21572407
MIRT550239	hsa-miR-7-2-3p	PAR-CLIP	21572407
MIRT293655	hsa-miR-519a-3p	PAR-CLIP	21572407
MIRT293653	hsa-miR-519b-3p	PAR-CLIP	21572407
MIRT293651	hsa-miR-519c-3p	PAR-CLIP	21572407
MIRT293648	hsa-miR-142-5p	PAR-CLIP	21572407
MIRT293656	hsa-miR-5590-3p	PAR-CLIP	21572407
MIRT082458	hsa-miR-4272	PAR-CLIP	21572407
MIRT1278040	hsa-miR-101	CLIP-seq
MIRT1278041	hsa-miR-1224-3p	CLIP-seq
MIRT1278042	hsa-miR-1225-3p	CLIP-seq
MIRT1278043	hsa-miR-1233	CLIP-seq
MIRT1278044	hsa-miR-1237	CLIP-seq
MIRT1278045	hsa-miR-1243	CLIP-seq
MIRT1278046	hsa-miR-1260	CLIP-seq
MIRT1278047	hsa-miR-1260b	CLIP-seq
MIRT1278048	hsa-miR-1273e	CLIP-seq
MIRT1278049	hsa-miR-1280	CLIP-seq
MIRT1278050	hsa-miR-1285	CLIP-seq
MIRT1278051	hsa-miR-1287	CLIP-seq
MIRT1278052	hsa-miR-150	CLIP-seq
MIRT1278053	hsa-miR-1912	CLIP-seq
MIRT1278054	hsa-miR-193a-5p	CLIP-seq
MIRT1278055	hsa-miR-199a-3p	CLIP-seq
MIRT1278056	hsa-miR-199b-3p	CLIP-seq
MIRT1278057	hsa-miR-2276	CLIP-seq
MIRT1278058	hsa-miR-2278	CLIP-seq
MIRT1278059	hsa-miR-28-5p	CLIP-seq
MIRT1278060	hsa-miR-296-5p	CLIP-seq
MIRT1278061	hsa-miR-298	CLIP-seq
MIRT1278062	hsa-miR-3065-5p	CLIP-seq
MIRT1278063	hsa-miR-3129-5p	CLIP-seq
MIRT1278064	hsa-miR-3135b	CLIP-seq
MIRT1278065	hsa-miR-3136-3p	CLIP-seq
MIRT1278066	hsa-miR-3139	CLIP-seq
MIRT1278067	hsa-miR-3187-5p	CLIP-seq
MIRT1278068	hsa-miR-3188	CLIP-seq
MIRT1278069	hsa-miR-3192	CLIP-seq
MIRT1278070	hsa-miR-3201	CLIP-seq
MIRT1278071	hsa-miR-328	CLIP-seq
MIRT1278072	hsa-miR-33a	CLIP-seq
MIRT1278073	hsa-miR-33b	CLIP-seq
MIRT1278074	hsa-miR-3614-3p	CLIP-seq
MIRT1278075	hsa-miR-3649	CLIP-seq
MIRT1278076	hsa-miR-3672	CLIP-seq
MIRT1278077	hsa-miR-3944-5p	CLIP-seq
MIRT1278078	hsa-miR-4287	CLIP-seq
MIRT1278079	hsa-miR-4303	CLIP-seq
MIRT1278080	hsa-miR-4314	CLIP-seq
MIRT1278081	hsa-miR-4433	CLIP-seq
MIRT1278082	hsa-miR-4447	CLIP-seq
MIRT1278083	hsa-miR-4459	CLIP-seq
MIRT1278084	hsa-miR-4469	CLIP-seq
MIRT1278085	hsa-miR-4472	CLIP-seq
MIRT1278086	hsa-miR-4640-5p	CLIP-seq
MIRT1278087	hsa-miR-4643	CLIP-seq
MIRT1278088	hsa-miR-4645-3p	CLIP-seq
MIRT1278089	hsa-miR-4646-5p	CLIP-seq
MIRT1278090	hsa-miR-4653-3p	CLIP-seq
MIRT1278091	hsa-miR-466	CLIP-seq
MIRT1278092	hsa-miR-4660	CLIP-seq
MIRT1278093	hsa-miR-4682	CLIP-seq
MIRT1278094	hsa-miR-4685-3p	CLIP-seq
MIRT1278095	hsa-miR-4713-5p	CLIP-seq
MIRT1278096	hsa-miR-4716-5p	CLIP-seq
MIRT1278097	hsa-miR-4722-5p	CLIP-seq
MIRT1278098	hsa-miR-4726-5p	CLIP-seq
MIRT1278099	hsa-miR-4760-5p	CLIP-seq
MIRT1278100	hsa-miR-4768-5p	CLIP-seq
MIRT1278101	hsa-miR-4772-3p	CLIP-seq
MIRT1278102	hsa-miR-4786-5p	CLIP-seq
MIRT1278103	hsa-miR-4789-3p	CLIP-seq
MIRT1278104	hsa-miR-4791	CLIP-seq
MIRT1278105	hsa-miR-508-5p	CLIP-seq
MIRT1278106	hsa-miR-5096	CLIP-seq
MIRT1278107	hsa-miR-520g	CLIP-seq
MIRT1278108	hsa-miR-520h	CLIP-seq
MIRT1278109	hsa-miR-532-3p	CLIP-seq
MIRT1278110	hsa-miR-541	CLIP-seq
MIRT1278111	hsa-miR-542-3p	CLIP-seq
MIRT1278112	hsa-miR-548a-3p	CLIP-seq
MIRT1278113	hsa-miR-548ah	CLIP-seq
MIRT1278114	hsa-miR-548e	CLIP-seq
MIRT1278115	hsa-miR-548f	CLIP-seq
MIRT1278116	hsa-miR-584	CLIP-seq
MIRT1278117	hsa-miR-612	CLIP-seq
MIRT1278118	hsa-miR-635	CLIP-seq
MIRT1278119	hsa-miR-646	CLIP-seq
MIRT1278120	hsa-miR-654-5p	CLIP-seq
MIRT1278121	hsa-miR-661	CLIP-seq
MIRT1278122	hsa-miR-662	CLIP-seq
MIRT1278123	hsa-miR-665	CLIP-seq
MIRT1278124	hsa-miR-708	CLIP-seq
MIRT1278125	hsa-miR-765	CLIP-seq
MIRT1278126	hsa-miR-766	CLIP-seq
MIRT1278127	hsa-miR-769-5p	CLIP-seq
MIRT1278128	hsa-miR-877	CLIP-seq
MIRT1278129	hsa-miR-936	CLIP-seq
MIRT1278130	hsa-miR-942	CLIP-seq
MIRT1278131	hsa-miR-3065-3p	CLIP-seq
MIRT1278132	hsa-miR-3156-3p	CLIP-seq
MIRT1278133	hsa-miR-3202	CLIP-seq
MIRT1278134	hsa-miR-3607-3p	CLIP-seq
MIRT1278135	hsa-miR-3664-5p	CLIP-seq
MIRT1278136	hsa-miR-3686	CLIP-seq
MIRT1278137	hsa-miR-380	CLIP-seq
MIRT1278138	hsa-miR-4301	CLIP-seq
MIRT1278139	hsa-miR-4533	CLIP-seq
MIRT1278140	hsa-miR-512-5p	CLIP-seq
MIRT1278040	hsa-miR-101	CLIP-seq
MIRT1278141	hsa-miR-1184	CLIP-seq
MIRT1278142	hsa-miR-1301	CLIP-seq
MIRT1278143	hsa-miR-137	CLIP-seq
MIRT1278144	hsa-miR-25	CLIP-seq
MIRT1278061	hsa-miR-298	CLIP-seq
MIRT1278145	hsa-miR-3122	CLIP-seq
MIRT1278146	hsa-miR-3184	CLIP-seq
MIRT1278147	hsa-miR-32	CLIP-seq
MIRT1278148	hsa-miR-342-5p	CLIP-seq
MIRT1278134	hsa-miR-3607-3p	CLIP-seq
MIRT1278149	hsa-miR-363	CLIP-seq
MIRT1278150	hsa-miR-367	CLIP-seq
MIRT1278151	hsa-miR-3674	CLIP-seq
MIRT1278152	hsa-miR-3678-3p	CLIP-seq
MIRT1278136	hsa-miR-3686	CLIP-seq
MIRT1278153	hsa-miR-3689a-3p	CLIP-seq
MIRT1278154	hsa-miR-3689c	CLIP-seq
MIRT1278155	hsa-miR-3714	CLIP-seq
MIRT1278156	hsa-miR-3913-5p	CLIP-seq
MIRT1278157	hsa-miR-423-5p	CLIP-seq
MIRT1278158	hsa-miR-4266	CLIP-seq
MIRT1278159	hsa-miR-4445	CLIP-seq
MIRT1278088	hsa-miR-4645-3p	CLIP-seq
MIRT1278160	hsa-miR-4651	CLIP-seq
MIRT1278092	hsa-miR-4660	CLIP-seq
MIRT1278161	hsa-miR-4662a-5p	CLIP-seq
MIRT1278162	hsa-miR-4664-5p	CLIP-seq
MIRT1278163	hsa-miR-4676-5p	CLIP-seq
MIRT1278164	hsa-miR-4688	CLIP-seq
MIRT1278165	hsa-miR-4695-5p	CLIP-seq
MIRT1278166	hsa-miR-4728-5p	CLIP-seq
MIRT1278167	hsa-miR-4761-5p	CLIP-seq
MIRT1278168	hsa-miR-4779	CLIP-seq
MIRT1278169	hsa-miR-486-3p	CLIP-seq
MIRT1278170	hsa-miR-500a	CLIP-seq
MIRT1278171	hsa-miR-5047	CLIP-seq
MIRT1278172	hsa-miR-549	CLIP-seq
MIRT1278173	hsa-miR-566	CLIP-seq
MIRT1278174	hsa-miR-575	CLIP-seq
MIRT1278175	hsa-miR-604	CLIP-seq
MIRT1278176	hsa-miR-608	CLIP-seq
MIRT1278177	hsa-miR-647	CLIP-seq
MIRT1278178	hsa-miR-651	CLIP-seq
MIRT1278179	hsa-miR-92a	CLIP-seq
MIRT1278180	hsa-miR-92b	CLIP-seq
MIRT1278181	hsa-miR-940	CLIP-seq
MIRT1552797	hsa-miR-3194-3p	CLIP-seq
MIRT1552798	hsa-miR-4487	CLIP-seq
MIRT1552799	hsa-miR-516a-5p	CLIP-seq
MIRT1278042	hsa-miR-1225-3p	CLIP-seq
MIRT2081872	hsa-miR-1229	CLIP-seq
MIRT1278043	hsa-miR-1233	CLIP-seq
MIRT2081873	hsa-miR-1254	CLIP-seq
MIRT2081874	hsa-miR-1262	CLIP-seq
MIRT1278048	hsa-miR-1273e	CLIP-seq
MIRT1278050	hsa-miR-1285	CLIP-seq
MIRT2081875	hsa-miR-1294	CLIP-seq
MIRT2081876	hsa-miR-1343	CLIP-seq
MIRT2081877	hsa-miR-149	CLIP-seq
MIRT1278054	hsa-miR-193a-5p	CLIP-seq
MIRT2081878	hsa-miR-197	CLIP-seq
MIRT2081879	hsa-miR-223	CLIP-seq
MIRT2081880	hsa-miR-2861	CLIP-seq
MIRT1278061	hsa-miR-298	CLIP-seq
MIRT1278131	hsa-miR-3065-3p	CLIP-seq
MIRT2081881	hsa-miR-3116	CLIP-seq
MIRT1278145	hsa-miR-3122	CLIP-seq
MIRT1278064	hsa-miR-3135b	CLIP-seq
MIRT2081882	hsa-miR-3138	CLIP-seq
MIRT1278067	hsa-miR-3187-5p	CLIP-seq
MIRT1552797	hsa-miR-3194-3p	CLIP-seq
MIRT2081883	hsa-miR-34a	CLIP-seq
MIRT2081884	hsa-miR-34c-3p	CLIP-seq
MIRT2081885	hsa-miR-34c-5p	CLIP-seq
MIRT1278134	hsa-miR-3607-3p	CLIP-seq
MIRT2081886	hsa-miR-3614-5p	CLIP-seq
MIRT1278076	hsa-miR-3672	CLIP-seq
MIRT2081887	hsa-miR-3682-5p	CLIP-seq
MIRT1278136	hsa-miR-3686	CLIP-seq
MIRT1278153	hsa-miR-3689a-3p	CLIP-seq
MIRT1278154	hsa-miR-3689c	CLIP-seq
MIRT1278155	hsa-miR-3714	CLIP-seq
MIRT1278156	hsa-miR-3913-5p	CLIP-seq
MIRT2081888	hsa-miR-3929	CLIP-seq
MIRT2081889	hsa-miR-4291	CLIP-seq
MIRT2081890	hsa-miR-4325	CLIP-seq
MIRT2081891	hsa-miR-4419b	CLIP-seq
MIRT1278082	hsa-miR-4447	CLIP-seq
MIRT1278083	hsa-miR-4459	CLIP-seq
MIRT2081892	hsa-miR-4468	CLIP-seq
MIRT1278085	hsa-miR-4472	CLIP-seq
MIRT2081893	hsa-miR-4478	CLIP-seq
MIRT1552798	hsa-miR-4487	CLIP-seq
MIRT2081894	hsa-miR-449a	CLIP-seq
MIRT2081895	hsa-miR-449b	CLIP-seq
MIRT1278089	hsa-miR-4646-5p	CLIP-seq
MIRT1278090	hsa-miR-4653-3p	CLIP-seq
MIRT2081896	hsa-miR-4679	CLIP-seq
MIRT2081897	hsa-miR-4695-3p	CLIP-seq
MIRT2081898	hsa-miR-4697-3p	CLIP-seq
MIRT2081899	hsa-miR-4701-3p	CLIP-seq
MIRT1278097	hsa-miR-4722-5p	CLIP-seq
MIRT1278166	hsa-miR-4728-5p	CLIP-seq
MIRT2081900	hsa-miR-4731-5p	CLIP-seq
MIRT2081901	hsa-miR-4760-3p	CLIP-seq
MIRT2081902	hsa-miR-4800-5p	CLIP-seq
MIRT2081903	hsa-miR-485-5p	CLIP-seq
MIRT1278170	hsa-miR-500a	CLIP-seq
MIRT1278105	hsa-miR-508-5p	CLIP-seq
MIRT1552799	hsa-miR-516a-5p	CLIP-seq
MIRT1278110	hsa-miR-541	CLIP-seq
MIRT2081904	hsa-miR-544	CLIP-seq
MIRT1278116	hsa-miR-584	CLIP-seq
MIRT1278117	hsa-miR-612	CLIP-seq
MIRT1278118	hsa-miR-635	CLIP-seq
MIRT1278120	hsa-miR-654-5p	CLIP-seq
MIRT1278121	hsa-miR-661	CLIP-seq
MIRT2081905	hsa-miR-760	CLIP-seq
MIRT1278125	hsa-miR-765	CLIP-seq
MIRT1278128	hsa-miR-877	CLIP-seq
MIRT1278181	hsa-miR-940	CLIP-seq
MIRT1278131	hsa-miR-3065-3p	CLIP-seq
MIRT1278140	hsa-miR-512-5p	CLIP-seq
MIRT1278050	hsa-miR-1285	CLIP-seq
MIRT1278054	hsa-miR-193a-5p	CLIP-seq
MIRT2393272	hsa-miR-24	CLIP-seq
MIRT1278062	hsa-miR-3065-5p	CLIP-seq
MIRT1278145	hsa-miR-3122	CLIP-seq
MIRT1278067	hsa-miR-3187-5p	CLIP-seq
MIRT2393273	hsa-miR-326	CLIP-seq
MIRT2393274	hsa-miR-330-5p	CLIP-seq
MIRT1278134	hsa-miR-3607-3p	CLIP-seq
MIRT1278136	hsa-miR-3686	CLIP-seq
MIRT1278153	hsa-miR-3689a-3p	CLIP-seq
MIRT1278154	hsa-miR-3689c	CLIP-seq
MIRT1278156	hsa-miR-3913-5p	CLIP-seq
MIRT2393275	hsa-miR-4284	CLIP-seq
MIRT1278093	hsa-miR-4682	CLIP-seq
MIRT1278166	hsa-miR-4728-5p	CLIP-seq
MIRT1278170	hsa-miR-500a	CLIP-seq
MIRT1278105	hsa-miR-508-5p	CLIP-seq
MIRT2393276	hsa-miR-510	CLIP-seq
MIRT1278117	hsa-miR-612	CLIP-seq
MIRT2393277	hsa-miR-627	CLIP-seq
MIRT1278121	hsa-miR-661	CLIP-seq
MIRT1278126	hsa-miR-766	CLIP-seq
MIRT2393278	hsa-miR-924	CLIP-seq
MIRT1278130	hsa-miR-942	CLIP-seq
MIRT2442538	hsa-miR-145	CLIP-seq
MIRT2442539	hsa-miR-4328	CLIP-seq
MIRT1278042	hsa-miR-1225-3p	CLIP-seq
MIRT1278043	hsa-miR-1233	CLIP-seq
MIRT2457490	hsa-miR-129-3p	CLIP-seq
MIRT2457491	hsa-miR-193a-3p	CLIP-seq
MIRT2457492	hsa-miR-193b	CLIP-seq
MIRT2457493	hsa-miR-3121-5p	CLIP-seq
MIRT1278145	hsa-miR-3122	CLIP-seq
MIRT2457494	hsa-miR-3176	CLIP-seq
MIRT1278134	hsa-miR-3607-3p	CLIP-seq
MIRT2457495	hsa-miR-3620	CLIP-seq
MIRT1278136	hsa-miR-3686	CLIP-seq
MIRT1278153	hsa-miR-3689a-3p	CLIP-seq
MIRT1278154	hsa-miR-3689c	CLIP-seq
MIRT1278156	hsa-miR-3913-5p	CLIP-seq
MIRT2457496	hsa-miR-3922-3p	CLIP-seq
MIRT1278166	hsa-miR-4728-5p	CLIP-seq
MIRT2457497	hsa-miR-4757-5p	CLIP-seq
MIRT2457498	hsa-miR-4780	CLIP-seq
MIRT1278170	hsa-miR-500a	CLIP-seq
MIRT2605052	hsa-miR-1181	CLIP-seq
MIRT2605053	hsa-miR-1227	CLIP-seq
MIRT2605054	hsa-miR-125a-3p	CLIP-seq
MIRT2081874	hsa-miR-1262	CLIP-seq
MIRT2605055	hsa-miR-1281	CLIP-seq
MIRT1278051	hsa-miR-1287	CLIP-seq
MIRT2081875	hsa-miR-1294	CLIP-seq
MIRT2605056	hsa-miR-135a	CLIP-seq
MIRT2605057	hsa-miR-135b	CLIP-seq
MIRT1278059	hsa-miR-28-5p	CLIP-seq
MIRT1278145	hsa-miR-3122	CLIP-seq
MIRT1278064	hsa-miR-3135b	CLIP-seq
MIRT1278066	hsa-miR-3139	CLIP-seq
MIRT1278069	hsa-miR-3192	CLIP-seq
MIRT2605058	hsa-miR-330-3p	CLIP-seq
MIRT1278134	hsa-miR-3607-3p	CLIP-seq
MIRT2605059	hsa-miR-3616-3p	CLIP-seq
MIRT1278136	hsa-miR-3686	CLIP-seq
MIRT1278153	hsa-miR-3689a-3p	CLIP-seq
MIRT1278154	hsa-miR-3689c	CLIP-seq
MIRT1278155	hsa-miR-3714	CLIP-seq
MIRT1278156	hsa-miR-3913-5p	CLIP-seq
MIRT2605060	hsa-miR-3934	CLIP-seq
MIRT2605061	hsa-miR-4326	CLIP-seq
MIRT2605062	hsa-miR-4436b-3p	CLIP-seq
MIRT2605063	hsa-miR-4440	CLIP-seq
MIRT2605064	hsa-miR-4677-3p	CLIP-seq
MIRT2081899	hsa-miR-4701-3p	CLIP-seq
MIRT2605065	hsa-miR-4715-3p	CLIP-seq
MIRT2605066	hsa-miR-4717-3p	CLIP-seq
MIRT1278097	hsa-miR-4722-5p	CLIP-seq
MIRT1278166	hsa-miR-4728-5p	CLIP-seq
MIRT2081903	hsa-miR-485-5p	CLIP-seq
MIRT1278170	hsa-miR-500a	CLIP-seq
MIRT2081904	hsa-miR-544	CLIP-seq
MIRT2605067	hsa-miR-580	CLIP-seq
MIRT2605068	hsa-miR-671-5p	CLIP-seq
MIRT1278124	hsa-miR-708	CLIP-seq
MIRT2605069	hsa-miR-764	CLIP-seq
MIRT1278181	hsa-miR-940	CLIP-seq
MIRT2605053	hsa-miR-1227	CLIP-seq
MIRT2081874	hsa-miR-1262	CLIP-seq
MIRT1278051	hsa-miR-1287	CLIP-seq
MIRT2081875	hsa-miR-1294	CLIP-seq
MIRT2457491	hsa-miR-193a-3p	CLIP-seq
MIRT2457492	hsa-miR-193b	CLIP-seq
MIRT1278059	hsa-miR-28-5p	CLIP-seq
MIRT1278145	hsa-miR-3122	CLIP-seq
MIRT1278064	hsa-miR-3135b	CLIP-seq
MIRT1278066	hsa-miR-3139	CLIP-seq
MIRT2689165	hsa-miR-3151	CLIP-seq
MIRT2457494	hsa-miR-3176	CLIP-seq
MIRT2605058	hsa-miR-330-3p	CLIP-seq
MIRT1278134	hsa-miR-3607-3p	CLIP-seq
MIRT1278135	hsa-miR-3664-5p	CLIP-seq
MIRT1278136	hsa-miR-3686	CLIP-seq
MIRT1278153	hsa-miR-3689a-3p	CLIP-seq
MIRT1278154	hsa-miR-3689c	CLIP-seq
MIRT1278155	hsa-miR-3714	CLIP-seq
MIRT1278156	hsa-miR-3913-5p	CLIP-seq
MIRT2457496	hsa-miR-3922-3p	CLIP-seq
MIRT2605061	hsa-miR-4326	CLIP-seq
MIRT1278082	hsa-miR-4447	CLIP-seq
MIRT1278085	hsa-miR-4472	CLIP-seq
MIRT2081899	hsa-miR-4701-3p	CLIP-seq
MIRT2605065	hsa-miR-4715-3p	CLIP-seq
MIRT1278166	hsa-miR-4728-5p	CLIP-seq
MIRT2457497	hsa-miR-4757-5p	CLIP-seq
MIRT2689166	hsa-miR-491-5p	CLIP-seq
MIRT1278170	hsa-miR-500a	CLIP-seq
MIRT2081904	hsa-miR-544	CLIP-seq
MIRT2689167	hsa-miR-615-5p	CLIP-seq
MIRT1278124	hsa-miR-708	CLIP-seq
MIRT1278181	hsa-miR-940	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
ATM	Activation	21406724
ATM	Repression	21406724
TFAP2A	Unknown	9880562

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001618	Function	Virus receptor activity	IBA
GO:0001618	Function	Virus receptor activity	IEA
GO:0002860	Process	Positive regulation of natural killer cell mediated cytotoxicity directed against tumor cell target	IEA
GO:0002860	Process	Positive regulation of natural killer cell mediated cytotoxicity directed against tumor cell target	IMP	12913096
GO:0005515	Function	Protein binding	IPI	19011627, 21982860, 25416956, 28515320, 30591568, 31515488, 32296183, 33961781
GO:0005576	Component	Extracellular region	IEA
GO:0005615	Component	Extracellular space	TAS	2170108
GO:0005737	Component	Cytoplasm	TAS	2170108
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA	16304049
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0005912	Component	Adherens junction	IBA
GO:0005925	Component	Focal adhesion	HDA	21423176
GO:0007155	Process	Cell adhesion	IEA
GO:0007156	Process	Homophilic cell adhesion via plasma membrane adhesion molecules	IBA
GO:0007157	Process	Heterophilic cell-cell adhesion via plasma membrane cell adhesion molecules	IBA
GO:0007165	Process	Signal transduction	IEA
GO:0009986	Component	Cell surface	IDA	16831868
GO:0016020	Component	Membrane	IDA	12913096
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	TAS	2170108
GO:0038023	Function	Signaling receptor activity	TAS	2538245
GO:0042267	Process	Natural killer cell mediated cytotoxicity	IBA
GO:0042267	Process	Natural killer cell mediated cytotoxicity	IDA	8673704, 16582911, 36248894
GO:0042267	Process	Natural killer cell mediated cytotoxicity	IDA	38289706
GO:0042267	Process	Natural killer cell mediated cytotoxicity	IEA
GO:0042271	Process	Susceptibility to natural killer cell mediated cytotoxicity	IEA
GO:0042271	Process	Susceptibility to natural killer cell mediated cytotoxicity	IMP	12913096
GO:0045953	Process	Negative regulation of natural killer cell mediated cytotoxicity	IDA	23154388, 25870599
GO:0045953	Process	Negative regulation of natural killer cell mediated cytotoxicity	IDA	23154388
GO:0045953	Process	Negative regulation of natural killer cell mediated cytotoxicity	IEA
GO:0045954	Process	Positive regulation of natural killer cell mediated cytotoxicity	IMP	16304049
GO:0046718	Process	Symbiont entry into host cell	IEA
GO:0048018	Function	Receptor ligand activity	IDA	23154388, 31253644
GO:0048018	Function	Receptor ligand activity	IEA
GO:0050839	Function	Cell adhesion molecule binding	IEA
GO:0050839	Function	Cell adhesion molecule binding	IPI	12913096
GO:0060370	Process	Susceptibility to T cell mediated cytotoxicity	IDA	15039383
GO:0060370	Process	Susceptibility to T cell mediated cytotoxicity	IEA
GO:0098631	Function	Cell adhesion mediator activity	IBA

Other IDs

• MIM: 173850
• HGNC: 9705
• e!Ensembl: ENSG00000073008

Protein

• UniProt ID: P15151
• Protein name: Poliovirus receptor (Nectin-like protein 5) (NECL-5) (CD antigen CD155)
• Protein function: Mediates NK cell adhesion and triggers NK cell effector functions. Binds two different NK cell receptors: CD96 and CD226. These interactions accumulates at the cell-cell contact site, leading to the formation of a mature immunological synapse be
• PDB: 1DGI, 1NN8, 3EPC, 3EPD, 3EPF, 3J8F, 3J9F, 3UDW, 3URO, 4FQP, 6ARQ, 6ISC, 6O3O
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF07686	V-set	32 → 142	Immunoglobulin V-set domain	Domain
  PF08205	C2-set_2	147 → 232	CD80-like C2-set immunoglobulin domain	Domain

• Sequence:

  MARAMAAAWPLLLVALLVLSWPPPGTGDVVVQAPTQVPGFLGDSVTLPCYLQVPNMEVTH
  VSQLTWARHGESGSMAVFHQTQGPSYSESKRLEFVAARLGAELRNASLRMFGLRVEDEGN
  YTCLFVTFPQGSRSVDIWLRVLAKPQNTAEVQKVQLTGEPVPMARCVSTGGRPPAQITWH
  SDLGGMPNTSQVPGFLSGTVTVTSLWILVPSSQVDGKNVTCKVEHESFEKPQLLTVNLTV
  YYPPEVSISGYDNNWYLGQNEATLTCDARSNPEPTGYNWSTTMGPLPPFAVAQGAQLLIR
  PVDKPINTTLICNVTNALGARQAELTVQVKEGPPSEHSGISRNAIIFLVLGILVFLILLG
  IGIYFYWSKCSREVLWHCHLCPSSTEHASASANGHVSYSAVSRENSSSQDPQTEGTR

• Sequence length: 417

Pathways

KEGG:

Cell adhesion molecules

Reactome:

Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell
Nectin/Necl trans heterodimerization

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ALZHEIMER DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervical cancer	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GASTROESOPHAGEAL REFLUX DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LEUKEMIA, MYELOID, ACUTE	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of urinary bladder	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OROFACIAL CLEFT 1	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATIC NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PVR-related disorder	Benign; Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine carcinosarcoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	21499126		★☆☆☆☆ Found in Text Mining only
Acute monocytic leukemia	Monocytic Leukemia	BEFREE	29855615		★☆☆☆☆ Found in Text Mining only
Acute Myeloid Leukemia (AML-M2)	Leukemia	CTD_human_DG	29855615		★☆☆☆☆ Found in Text Mining only
Acute Myeloid Leukemia, M1	Myeloid Leukemia	CTD_human_DG	29855615		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	30880756		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of colon	Adenocarcinoma Of Colon	BEFREE	30880756		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	23276719		★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	11454801		★☆☆☆☆ Found in Text Mining only
Adenoma of large intestine	Colorectal adenoma	BEFREE	11454801		★☆☆☆☆ Found in Text Mining only
Adult Medulloblastoma	Medulloblastoma	BEFREE	29878245		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	28650998	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Alzheimer`s Disease	Alzheimer disease	GWASDB_DG	21460841, 24755620		★☆☆☆☆ Found in Text Mining only
Alzheimer`s Disease	Alzheimer disease	GWASCAT_DG	29777097, 30617256, 30805717		★☆☆☆☆ Found in Text Mining only
ANOPHTHALMIA AND PULMONARY HYPOPLASIA	Syndromic microphthalmia	BEFREE	29180478		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	28062492		★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	29878245	Associate	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	28062492		★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial Fibrillation	BEFREE	29069364		★☆☆☆☆ Found in Text Mining only
AURAL ATRESIA, CONGENITAL	Aural Atresia, Congenital	BEFREE	30012821		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	23980210	Associate	★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	30808363		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	31602268		★☆☆☆☆ Found in Text Mining only
Brain atrophy	Brain atrophy	BEFREE	31706897		★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	29878245		★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	29878245	Associate	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	15269159, 30039180, 31035013, 31176775, 31372841, 31741778, 31830330		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	31035013, 31372841, 31830330, 32411795, 34608548, 37643511	Associate	★☆☆☆☆ Found in Text Mining only
Bronchioloalveolar Adenocarcinoma	Lung adenocarcinoma	BEFREE	23276719		★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt`s Lymphoma	BEFREE	28829151		★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	15471548	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	26936487, 31485637, 35089611	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Merkel Cell	Merkel cell carcinoma	Pubtator	37573372	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	31602268		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	23276719		★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	37649613	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	33576304	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	33879814, 35262683	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	26563374		★☆☆☆☆ Found in Text Mining only
Cardiomyopathy Hypertrophic Familial	Cardiomyopathy	Pubtator	15858117	Associate	★☆☆☆☆ Found in Text Mining only
Carpal Tunnel Syndrome	Carpal tunnel syndrome	Pubtator	37878141	Associate	★☆☆☆☆ Found in Text Mining only
Cerebral atrophy	Cerebral Atrophy	BEFREE	31706897		★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	30422209, 31103695, 31699376		★☆☆☆☆ Found in Text Mining only
Childhood Medulloblastoma	Medulloblastoma	BEFREE	29878245		★☆☆☆☆ Found in Text Mining only
Cholangiocarcinoma	Cholangiocarcinoma	BEFREE	28814880		★☆☆☆☆ Found in Text Mining only
Cleft Lip with or without Cleft Palate	Cleft Lip With Or Without Cleft Palate	BEFREE	18356023, 20662561		★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	28816021		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic Neoplasms	BEFREE	11454801, 9538119		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	11454801, 22189020	Stimulate	★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	33576304	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	11454801, 28816021, 30880756, 31090213		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	11454801	Stimulate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	34353426, 35324958	Associate	★☆☆☆☆ Found in Text Mining only
Congenital contractural arachnodactyly	Congenital Contractural Arachnodactyly	BEFREE	28814880		★☆☆☆☆ Found in Text Mining only
Connective Tissue Diseases	Connective Tissue Disease	BEFREE	30719004		★☆☆☆☆ Found in Text Mining only
Cutaneous Melanoma	Melanoma	BEFREE	22929570		★☆☆☆☆ Found in Text Mining only
Dermatomyositis	Dermatomyositis	Pubtator	37491355	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	12629650, 31250262		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	12629650, 31250262		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	37878141	Associate	★☆☆☆☆ Found in Text Mining only
Dystrophia myotonica 2	Myotonic dystrophy	BEFREE	28945275		★☆☆☆☆ Found in Text Mining only
Encephalitis, Polio	Encephalitis	CTD_human_DG	28446605, 3020560		★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	BEFREE	22926846		★☆☆☆☆ Found in Text Mining only
Epiretinal Membrane	Epiretinal Membrane	BEFREE	7843589		★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	26563374		★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	38619620	Associate	★☆☆☆☆ Found in Text Mining only
Fibrosarcoma	Fibrosarcoma	BEFREE	19029379		★☆☆☆☆ Found in Text Mining only
Gastrointestinal Neoplasms	Gastrointestinal neoplasm	Pubtator	35094125	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	15471548, 22363471, 31377744	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	16489093, 20299272, 20680398, 28829151, 31377744		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	16489093, 20299272, 20680398, 28829151, 31377744		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	LHGDN	15279713		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	15279713, 18951922, 22363471, 31377744	Associate	★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	16322240, 19795504, 31377744		★☆☆☆☆ Found in Text Mining only
Hematologic Neoplasms	Hematologic Neoplasms	BEFREE	26588911		★☆☆☆☆ Found in Text Mining only
Hepatoblastoma	Hepatoblastoma	Pubtator	21622149	Associate	★☆☆☆☆ Found in Text Mining only
Hereditary Breast and Ovarian Cancer Syndrome	Hereditary breast and ovarian cancer syndrome	Pubtator	34608548	Associate	★☆☆☆☆ Found in Text Mining only
Hypertension Pulmonary	Pulmonary hypertension	Pubtator	30881226	Associate	★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	30086741, 31121149, 31665907		★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary hypertension	Pulmonary Hypertension	BEFREE	30719004		★☆☆☆☆ Found in Text Mining only
Intestinal Diseases	Intestinal disease	Pubtator	11454801	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	BEFREE	29979643		★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	LHGDN	15536144		★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	27838340		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	37919606	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid	Myeloid leukemia	Pubtator	15536144	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	26246143, 30639819	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	21499126, 26246143, 26588911, 29855615, 30639819		★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	CTD_human_DG	29855615		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	25320021, 31485637, 9538119		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	33879814, 37565582	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	28108989		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	20331633	Stimulate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	27788211, 31035013	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	30659053	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma, T-Cell, Cutaneous	Lymphoma	BEFREE	28395975		★☆☆☆☆ Found in Text Mining only
Malignant Glioma	Glioma	BEFREE	22692919, 28829151		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	15269159, 30039180, 31035013, 31176775, 31372841, 31741778, 31830330		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	23276719		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	25862891		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	30374653, 30614027		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	CTD_human_DG	30614027		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	28883004		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	31602268		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	16322240, 20299272, 23276719, 24468679, 25862891, 28084312, 28395975, 28730595, 28814880, 29725446, 30132062, 30275538, 30555485, 30880756, 31090213, 31176775, 31325728		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	28816021		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	15269159, 31176775		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	BEFREE	29878245		★☆☆☆☆ Found in Text Mining only
Medulloblastoma	Medulloblastoma	Pubtator	29878245, 35296518	Associate	★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	22929570, 28775208		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Melanoma	Pubtator	22929570, 26763445	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma Cutaneous Malignant	Melanoma	Pubtator	33576304	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic syndrome	Pubtator	36078120	Associate	★☆☆☆☆ Found in Text Mining only
MILES-CARPENTER X-LINKED MENTAL RETARDATION SYNDROME	MILES-CARPENTER X-Linked MENTAL RETARDATION SYNDROME	BEFREE	29163104		★☆☆☆☆ Found in Text Mining only
Monoclonal Gammopathy of Undetermined Significance	Monoclonal Gammapathies	BEFREE	28456791		★☆☆☆☆ Found in Text Mining only
Motor Neuron Disease	Motor Neuron Disease	BEFREE	15076773		★☆☆☆☆ Found in Text Mining only
Motor Neuron Disease	Motor neuron disease	Pubtator	15858117	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	25609078, 26269456, 28456791		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	25609078, 26269456, 28874810, 37239949	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	15465608		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple sclerosis	Pubtator	25526461, 27162345, 31932685	Associate	★☆☆☆☆ Found in Text Mining only
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	29941459, 36651499	Associate	★☆☆☆☆ Found in Text Mining only
Myeloid Leukemia	Myeloid Leukemia	LHGDN	15536144		★☆☆☆☆ Found in Text Mining only
Myositis	Myositis	Pubtator	37491355	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	11454801, 15279713, 16489093, 20299272, 24468679, 25320021, 25384044, 25862891, 28395975, 28730595, 28814880, 28829151, 28874810, 29217528, 29757192, 29757194, 29868026, 29943666, 30275538, 30374653, 30411378, 30504141, 30555485, 31035013, 31036057, 31325728, 31372841, 31383549, 9538119		★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	26983733		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	22692919		★☆☆☆☆ Found in Text Mining only
Orofacial cleft	Orofacial Cleft	BEFREE	20662561		★☆☆☆☆ Found in Text Mining only
OROFACIAL CLEFT 1	Orofacial Cleft	CTD_human_DG	21637507		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Osteosarcoma	Osteosarcoma	BEFREE	29725446		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	32446718	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	25862891		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	27626490	Associate	★☆☆☆☆ Found in Text Mining only
Paraparesis Tropical Spastic	Tropical spastic paraparesis	Pubtator	33767694	Stimulate	★☆☆☆☆ Found in Text Mining only
Pleomorphic Xanthoastrocytoma	Pleomorphic Xanthoastrocytoma	BEFREE	29878245		★☆☆☆☆ Found in Text Mining only
Polycythemia Vera	Polycythemia Vera	BEFREE	21998457, 24784416		★☆☆☆☆ Found in Text Mining only
Portal Vein Thrombosis	Portal Vein Thrombosis	BEFREE	29113006		★☆☆☆☆ Found in Text Mining only
Precursor Cell Lymphoblastic Leukemia Lymphoma	Lymphoblastic Leukemia	BEFREE	21499126		★☆☆☆☆ Found in Text Mining only
Proliferative vitreoretinopathy	Proliferative Vitreoretinopathy	BEFREE	24045107, 31661651		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	30374653, 30614027		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	CTD_human_DG	30614027		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	35465350	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ptosis	Ptosis	BEFREE	30912192		★☆☆☆☆ Found in Text Mining only
Retinal Detachment	Retinal Detachment	BEFREE	15111604, 31185026		★☆☆☆☆ Found in Text Mining only
Rhegmatogenous retinal detachment	Rhegmatogenous retinal detachment	BEFREE	28862256, 31129751, 31163427, 31661651		★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	22692919		★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	Pubtator	32082316	Associate	★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	9131645		★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	28610918		★☆☆☆☆ Found in Text Mining only
Small cell carcinoma of lung	Lung carcinoma	BEFREE	30854074		★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	33469055, 35947095	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	27788211		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	32719094, 33576304, 36268020	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	31387897		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	28883004		★☆☆☆☆ Found in Text Mining only
Stomach Diseases	Stomach disease	Pubtator	37441080	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	36430322, 36680216, 37441080	Associate	★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	30599005		★☆☆☆☆ Found in Text Mining only
Tetralogy of Fallot	Tetralogy of Fallot	BEFREE	30201112, 30587056		★☆☆☆☆ Found in Text Mining only
Thyroid cancer medullary	Medullary thyroid cancer	Pubtator	32242507	Associate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	31372841, 31830330, 32411795, 34115802, 36544779, 38216949	Associate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	31741778, 31830330		★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	33576304	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	33185939, 35729552	Associate	★☆☆☆☆ Found in Text Mining only
Van der Woude syndrome	Van Der Woude Syndrome	BEFREE	14994877		★☆☆☆☆ Found in Text Mining only
Zlotogora-Ogur syndrome	Cleft lip/palate-ectodermal dysplasia syndrome	BEFREE	14994877		★☆☆☆☆ Found in Text Mining only