NGB (neuroglobin)

Gene

• Entrez ID: 58157
• Gene name: Neuroglobin
• Gene symbol: NGB
• Synonyms (NCBI Gene): -
• Chromosome: 14
• Chromosome location: 14q24.3
• Summary: This gene encodes an oxygen-binding protein that is distantly related to members of the globin gene family. It is highly conserved among other vertebrates. It is expressed in the central and peripheral nervous system where it may be involved in increasing

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT756133	hsa-miR-320a	Luciferase reporter assay, Western blotting, qRT-PCR	34584546
MIRT1184061	hsa-miR-1184	CLIP-seq
MIRT1184062	hsa-miR-1205	CLIP-seq
MIRT1184063	hsa-miR-1207-3p	CLIP-seq
MIRT1184064	hsa-miR-1237	CLIP-seq
MIRT1184065	hsa-miR-1248	CLIP-seq
MIRT1184066	hsa-miR-1254	CLIP-seq
MIRT1184067	hsa-miR-1301	CLIP-seq
MIRT1184068	hsa-miR-28-5p	CLIP-seq
MIRT1184069	hsa-miR-3116	CLIP-seq
MIRT1184070	hsa-miR-3127-5p	CLIP-seq
MIRT1184071	hsa-miR-3130-3p	CLIP-seq
MIRT1184072	hsa-miR-3139	CLIP-seq
MIRT1184073	hsa-miR-3150b-3p	CLIP-seq
MIRT1184074	hsa-miR-3156-3p	CLIP-seq
MIRT1184075	hsa-miR-3158-5p	CLIP-seq
MIRT1184076	hsa-miR-3200-5p	CLIP-seq
MIRT1184077	hsa-miR-34a	CLIP-seq
MIRT1184078	hsa-miR-34c-5p	CLIP-seq
MIRT1184079	hsa-miR-3664-5p	CLIP-seq
MIRT1184080	hsa-miR-378	CLIP-seq
MIRT1184081	hsa-miR-378b	CLIP-seq
MIRT1184082	hsa-miR-378c	CLIP-seq
MIRT1184083	hsa-miR-378d	CLIP-seq
MIRT1184084	hsa-miR-378e	CLIP-seq
MIRT1184085	hsa-miR-378f	CLIP-seq
MIRT1184086	hsa-miR-378h	CLIP-seq
MIRT1184087	hsa-miR-378i	CLIP-seq
MIRT1184088	hsa-miR-3918	CLIP-seq
MIRT1184089	hsa-miR-422a	CLIP-seq
MIRT1184090	hsa-miR-4301	CLIP-seq
MIRT1184091	hsa-miR-4431	CLIP-seq
MIRT1184092	hsa-miR-449a	CLIP-seq
MIRT1184093	hsa-miR-449b	CLIP-seq
MIRT1184094	hsa-miR-4522	CLIP-seq
MIRT1184095	hsa-miR-4649-3p	CLIP-seq
MIRT1184096	hsa-miR-4660	CLIP-seq
MIRT1184097	hsa-miR-4689	CLIP-seq
MIRT1184098	hsa-miR-4757-5p	CLIP-seq
MIRT1184099	hsa-miR-4761-3p	CLIP-seq
MIRT1184100	hsa-miR-4784	CLIP-seq
MIRT1184101	hsa-miR-4793-3p	CLIP-seq
MIRT1184102	hsa-miR-483-3p	CLIP-seq
MIRT1184103	hsa-miR-5047	CLIP-seq
MIRT1184104	hsa-miR-532-3p	CLIP-seq
MIRT1184105	hsa-miR-544	CLIP-seq
MIRT1184106	hsa-miR-661	CLIP-seq
MIRT1184107	hsa-miR-663b	CLIP-seq
MIRT1184108	hsa-miR-708	CLIP-seq
MIRT2053380	hsa-miR-1324	CLIP-seq
MIRT2053381	hsa-miR-3189-5p	CLIP-seq
MIRT2053382	hsa-miR-4436a	CLIP-seq
MIRT2282598	hsa-miR-3074-5p	CLIP-seq
MIRT2282599	hsa-miR-548ag	CLIP-seq
MIRT2282600	hsa-miR-548ai	CLIP-seq
MIRT2282601	hsa-miR-548m	CLIP-seq
MIRT2391534	hsa-miR-1912	CLIP-seq
MIRT2391535	hsa-miR-3184	CLIP-seq
MIRT2391536	hsa-miR-423-5p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001666	Process	Response to hypoxia	IBA
GO:0005092	Function	GDP-dissociation inhibitor activity	IDA	12860983
GO:0005344	Function	Oxygen carrier activity	IBA
GO:0005344	Function	Oxygen carrier activity	IEA
GO:0005344	Function	Oxygen carrier activity	TAS	11029004
GO:0005515	Function	Protein binding	IPI	25416956, 32296183
GO:0005737	Component	Cytoplasm	IEA
GO:0005739	Component	Mitochondrion	IEA
GO:0005759	Component	Mitochondrial matrix	IEA
GO:0005829	Component	Cytosol	IEA
GO:0005829	Component	Cytosol	TAS
GO:0015671	Process	Oxygen transport	IBA
GO:0015671	Process	Oxygen transport	IEA
GO:0015671	Process	Oxygen transport	NAS	11029004
GO:0016491	Function	Oxidoreductase activity	IEA
GO:0019825	Function	Oxygen binding	IBA
GO:0019825	Function	Oxygen binding	IDA	11029004
GO:0019825	Function	Oxygen binding	IEA
GO:0020037	Function	Heme binding	IEA
GO:0046872	Function	Metal ion binding	IEA
GO:0071456	Process	Cellular response to hypoxia	IMP	18302932
GO:0098809	Function	Nitrite reductase activity	IDA	21296891

Other IDs

• MIM: 605304
• HGNC: 14077
• e!Ensembl: ENSG00000165553

Protein

• UniProt ID: Q9NPG2
• Protein name: Neuroglobin (Nitrite reductase) (EC 1.7.-.-)
• Protein function: Monomeric globin with a bis-histidyl six-coordinate heme-iron atom through which it can bind dioxygen, carbon monoxide and nitric oxide (PubMed:11473128, PubMed:12962627, PubMed:24699645). Could help transport oxygen and increase its availabilit
• PDB: 1OJ6, 4MPM, 7VQG, 8GRZ, 8WUB
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00042	Globin	5 → 114	Globin	Domain

• Tissue specificity: TISSUE SPECIFICITY: Predominantly expressed in brain, the strongest expression is seen in the frontal lobe, the subthalamic nucleus and the thalamus. {ECO:0000269|PubMed:11029004}.
• Sequence:

  MERPEPELIRQSWRAVSRSPLEHGTVLFARLFALEPDLLPLFQYNCRQFSSPEDCLSSPE
  FLDHIRKVMLVIDAAVTNVEDLSSLEEYLASLGRKHRAVGVKLSSFSTVGESLLYMLEKC
  LGPAFTPATRAAWSQLYGAVVQAMSRGWDGE

• Sequence length: 151

Pathways

Reactome:

Intracellular oxygen transport

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
CONOTRUNCAL HEART MALFORMATIONS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenocarcinoma	Adenocarcinoma	BEFREE	21640426		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	19010568	Associate	★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	27651453	Inhibit	★☆☆☆☆ Found in Text Mining only
Amyloid Neuropathies	Amyloid neuropathy	Pubtator	19010568	Associate	★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	BEFREE	24362753, 30010125		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	31158439		★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	29098407		★☆☆☆☆ Found in Text Mining only
Arteriovenous Malformations	Arteriovenous malformations	Pubtator	21725774	Associate	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	LHGDN	19087291		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	29098407		★☆☆☆☆ Found in Text Mining only
Bicuspid Aortic Valve Disease	Bicuspid aortic valve	Pubtator	36071494	Associate	★☆☆☆☆ Found in Text Mining only
Brain Injuries	Brain injuries	Pubtator	21725774, 39290417	Associate	★☆☆☆☆ Found in Text Mining only
Brain Injuries Traumatic	Brain injuries	Pubtator	20345238	Associate	★☆☆☆☆ Found in Text Mining only
Brain Ischemia	Brain ischemia	Pubtator	19087291	Associate	★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	20958924		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	29216269, 29219195		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	27149623, 27312786, 29216269, 33924212, 34440755	Associate	★☆☆☆☆ Found in Text Mining only
Cancer Pain	Cancer	Pubtator	37005662	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	19154338	Inhibit	★☆☆☆☆ Found in Text Mining only
Cerebral Hemorrhage	Cerebral hemorrhage	Pubtator	21725774	Associate	★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Cerebral Infarction	BEFREE	12621155, 17942367, 20467836, 21093435, 29802248		★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Ischemic stroke	Pubtator	19087291, 20075359, 21725774	Associate	★☆☆☆☆ Found in Text Mining only
Cerebral Infarction	Ischemic stroke	Pubtator	39290417	Stimulate	★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	12621155, 20640154, 27651453, 28246171, 28320188, 29802248, 30237546		★☆☆☆☆ Found in Text Mining only
CNS disorder	CNS Disorder	BEFREE	31173822		★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognitive disorder	BEFREE	29922222		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	37005662	Associate	★☆☆☆☆ Found in Text Mining only
Conn Syndrome	Conn Syndrome	BEFREE	30235329		★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	21480333		★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	Pubtator	17151062	Associate	★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	BEFREE	28540323		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	19383366, 28103511		★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	19383366, 24379112, 28103511		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	28103511, 28410531, 29207186		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	28410531	Associate	★☆☆☆☆ Found in Text Mining only
Heredodegenerative Disorders, Nervous System	Heredodegenerative Disorders, Nervous System	CTD_human_DG	16825958		★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	27957684, 29101592		★☆☆☆☆ Found in Text Mining only
Hypercholesterolemia	Hypercholesterolemia	Pubtator	19087291	Associate	★☆☆☆☆ Found in Text Mining only
Hypertension	Hypertension	Pubtator	19087291	Associate	★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	27928027		★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	19010568, 19154338, 21725774, 34943907	Associate	★☆☆☆☆ Found in Text Mining only
Hypoxic-Ischemic Encephalopathy	Hypoxic-Ischemic Encephalopathy	BEFREE	17942367, 29863263		★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	29922222		★☆☆☆☆ Found in Text Mining only
Intracranial Arteriovenous Malformations	Intracranial arteriovenous malformation	Pubtator	21725774	Stimulate	★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	19087291, 29416029		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	23478801		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	29216269, 29219195		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	20958924, 21640426, 23478801, 27637274, 29219195, 30421506, 31354909, 31686530		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	29098407		★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial Ischemia	BEFREE	29098407		★☆☆☆☆ Found in Text Mining only
Myocardial Ischemia	Myocardial ischemia	Pubtator	31882813	Associate	★☆☆☆☆ Found in Text Mining only
Necrosis	Necrosis	Pubtator	19154338	Inhibit	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	20958924, 23478801, 28103511, 28410531, 31354909		★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	30237546		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	17532579, 23429294, 29216269, 29378245		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	34943907	Associate	★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	28410531	Associate	★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	18025470, 27637274, 28410531, 28707399, 29982985, 30237546, 30361767		★☆☆☆☆ Found in Text Mining only
Neuroferritinopathy	Neuroferritinopathy	BEFREE	16825958		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	21640426		★☆☆☆☆ Found in Text Mining only
Retinitis Pigmentosa	Retinitis Pigmentosa	BEFREE	29038003		★☆☆☆☆ Found in Text Mining only
Sleep Apnea Obstructive	Sleep apnea	Pubtator	30235329	Associate	★☆☆☆☆ Found in Text Mining only
Sleep Apnea, Obstructive	Sleep Apnea	BEFREE	29922222, 30235329		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	21640426		★☆☆☆☆ Found in Text Mining only
Stroke	Stroke	Pubtator	19087291, 39290417	Associate	★☆☆☆☆ Found in Text Mining only
Stroke	Stroke	Pubtator	20075359	Stimulate	★☆☆☆☆ Found in Text Mining only
Stroke	Stroke	Pubtator	27651453	Inhibit	★☆☆☆☆ Found in Text Mining only
Subarachnoid Hemorrhage	Subarachnoid hemorrhage	BEFREE	28774717, 29738858		★☆☆☆☆ Found in Text Mining only