PTX3 (pentraxin 3)

Gene

• Entrez ID: 5806
• Gene name: Pentraxin 3
• Gene symbol: PTX3
• Synonyms (NCBI Gene): TNFAIP5, TSG-14
• Chromosome: 3
• Chromosome location: 3q25.32
• Summary: This gene encodes a member of the pentraxin protein family. The expression of this protein is induced by inflammatory cytokines in response to inflammatory stimuli in several mesenchymal and epithelial cell types, particularly endothelial cells and mononu

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT005954	hsa-miR-21-5p	Luciferase reporter assay	21131358
MIRT054880	hsa-miR-224-5p	Luciferase reporter assay, qRT-PCR, Western blot	24470395
MIRT736826	hsa-miR-377-3p	RNA-seq, qRT-PCR	33477862
MIRT1276844	hsa-miR-101	CLIP-seq
MIRT1276845	hsa-miR-144	CLIP-seq
MIRT1276846	hsa-miR-3163	CLIP-seq
MIRT1276847	hsa-miR-340	CLIP-seq
MIRT1276848	hsa-miR-4699-3p	CLIP-seq
MIRT1276849	hsa-miR-582-5p	CLIP-seq
MIRT1276850	hsa-miR-936	CLIP-seq
MIRT1552748	hsa-miR-129-5p	CLIP-seq
MIRT1552749	hsa-miR-142-5p	CLIP-seq
MIRT1552750	hsa-miR-1910	CLIP-seq
MIRT1552751	hsa-miR-2054	CLIP-seq
MIRT1552752	hsa-miR-29a	CLIP-seq
MIRT1552753	hsa-miR-29b	CLIP-seq
MIRT1552754	hsa-miR-29c	CLIP-seq
MIRT1552755	hsa-miR-3065-5p	CLIP-seq
MIRT1552756	hsa-miR-3143	CLIP-seq
MIRT1552757	hsa-miR-325	CLIP-seq
MIRT1552758	hsa-miR-337-3p	CLIP-seq
MIRT1552759	hsa-miR-3613-3p	CLIP-seq
MIRT1552760	hsa-miR-3622b-5p	CLIP-seq
MIRT1552761	hsa-miR-371-5p	CLIP-seq
MIRT1552762	hsa-miR-371b-5p	CLIP-seq
MIRT1552763	hsa-miR-3942-3p	CLIP-seq
MIRT1552764	hsa-miR-421	CLIP-seq
MIRT1552765	hsa-miR-4282	CLIP-seq
MIRT1552766	hsa-miR-4326	CLIP-seq
MIRT1552767	hsa-miR-4495	CLIP-seq
MIRT1552768	hsa-miR-4646-3p	CLIP-seq
MIRT1552769	hsa-miR-4682	CLIP-seq
MIRT1552770	hsa-miR-4693-3p	CLIP-seq
MIRT1552771	hsa-miR-4720-5p	CLIP-seq
MIRT1552772	hsa-miR-4760-3p	CLIP-seq
MIRT1552773	hsa-miR-4762-5p	CLIP-seq
MIRT1552774	hsa-miR-4766-5p	CLIP-seq
MIRT1552775	hsa-miR-4789-3p	CLIP-seq
MIRT1552776	hsa-miR-4799-3p	CLIP-seq
MIRT1552777	hsa-miR-513c	CLIP-seq
MIRT1552778	hsa-miR-514b-5p	CLIP-seq
MIRT1552779	hsa-miR-543	CLIP-seq
MIRT1552780	hsa-miR-548ag	CLIP-seq
MIRT1552781	hsa-miR-548ai	CLIP-seq
MIRT1552782	hsa-miR-548g	CLIP-seq
MIRT1552783	hsa-miR-548s	CLIP-seq
MIRT1552784	hsa-miR-628-3p	CLIP-seq
MIRT1552785	hsa-miR-642a	CLIP-seq
MIRT1552786	hsa-miR-767-5p	CLIP-seq
MIRT1552787	hsa-miR-802	CLIP-seq
MIRT1552788	hsa-miR-942	CLIP-seq
MIRT1552789	hsa-miR-944	CLIP-seq
MIRT1552749	hsa-miR-142-5p	CLIP-seq
MIRT1552752	hsa-miR-29a	CLIP-seq
MIRT1552753	hsa-miR-29b	CLIP-seq
MIRT1552754	hsa-miR-29c	CLIP-seq
MIRT1552758	hsa-miR-337-3p	CLIP-seq
MIRT1556895	hsa-miR-4255	CLIP-seq
MIRT1552766	hsa-miR-4326	CLIP-seq
MIRT1556896	hsa-miR-4474-5p	CLIP-seq
MIRT1556897	hsa-miR-450b-5p	CLIP-seq
MIRT1556898	hsa-miR-4753-3p	CLIP-seq
MIRT1556899	hsa-miR-491-3p	CLIP-seq
MIRT1556900	hsa-miR-501-3p	CLIP-seq
MIRT1556901	hsa-miR-502-3p	CLIP-seq
MIRT1556902	hsa-miR-507	CLIP-seq
MIRT1552777	hsa-miR-513c	CLIP-seq
MIRT1552778	hsa-miR-514b-5p	CLIP-seq
MIRT1556903	hsa-miR-557	CLIP-seq
MIRT1552786	hsa-miR-767-5p	CLIP-seq
MIRT1276844	hsa-miR-101	CLIP-seq
MIRT1276845	hsa-miR-144	CLIP-seq
MIRT1276846	hsa-miR-3163	CLIP-seq
MIRT1276848	hsa-miR-4699-3p	CLIP-seq
MIRT2081486	hsa-miR-4732-5p	CLIP-seq
MIRT1276849	hsa-miR-582-5p	CLIP-seq
MIRT1276850	hsa-miR-936	CLIP-seq
MIRT1552763	hsa-miR-3942-3p	CLIP-seq
MIRT1552769	hsa-miR-4682	CLIP-seq
MIRT1552749	hsa-miR-142-5p	CLIP-seq
MIRT1552750	hsa-miR-1910	CLIP-seq
MIRT1552751	hsa-miR-2054	CLIP-seq
MIRT1552752	hsa-miR-29a	CLIP-seq
MIRT1552753	hsa-miR-29b	CLIP-seq
MIRT1552754	hsa-miR-29c	CLIP-seq
MIRT1552755	hsa-miR-3065-5p	CLIP-seq
MIRT1552756	hsa-miR-3143	CLIP-seq
MIRT2432344	hsa-miR-3200-5p	CLIP-seq
MIRT1552757	hsa-miR-325	CLIP-seq
MIRT1552760	hsa-miR-3622b-5p	CLIP-seq
MIRT2432345	hsa-miR-3660	CLIP-seq
MIRT1552762	hsa-miR-371b-5p	CLIP-seq
MIRT1552764	hsa-miR-421	CLIP-seq
MIRT2432346	hsa-miR-4310	CLIP-seq
MIRT2432347	hsa-miR-4526	CLIP-seq
MIRT1552768	hsa-miR-4646-3p	CLIP-seq
MIRT1552770	hsa-miR-4693-3p	CLIP-seq
MIRT2081486	hsa-miR-4732-5p	CLIP-seq
MIRT1556898	hsa-miR-4753-3p	CLIP-seq
MIRT1552773	hsa-miR-4762-5p	CLIP-seq
MIRT1552774	hsa-miR-4766-5p	CLIP-seq
MIRT2432348	hsa-miR-520d-5p	CLIP-seq
MIRT2432349	hsa-miR-524-5p	CLIP-seq
MIRT1552779	hsa-miR-543	CLIP-seq
MIRT1552780	hsa-miR-548ag	CLIP-seq
MIRT1552781	hsa-miR-548ai	CLIP-seq
MIRT1552782	hsa-miR-548g	CLIP-seq
MIRT2432350	hsa-miR-595	CLIP-seq
MIRT1552784	hsa-miR-628-3p	CLIP-seq
MIRT1552785	hsa-miR-642a	CLIP-seq
MIRT1552786	hsa-miR-767-5p	CLIP-seq
MIRT1552787	hsa-miR-802	CLIP-seq
MIRT2432351	hsa-miR-9	CLIP-seq
MIRT1552789	hsa-miR-944	CLIP-seq
MIRT1552749	hsa-miR-142-5p	CLIP-seq
MIRT2604993	hsa-miR-205	CLIP-seq
MIRT1552752	hsa-miR-29a	CLIP-seq
MIRT1552753	hsa-miR-29b	CLIP-seq
MIRT1552754	hsa-miR-29c	CLIP-seq
MIRT2604994	hsa-miR-3124-3p	CLIP-seq
MIRT1552756	hsa-miR-3143	CLIP-seq
MIRT1552757	hsa-miR-325	CLIP-seq
MIRT1552762	hsa-miR-371b-5p	CLIP-seq
MIRT2432346	hsa-miR-4310	CLIP-seq
MIRT1552774	hsa-miR-4766-5p	CLIP-seq
MIRT2604995	hsa-miR-511	CLIP-seq
MIRT1552779	hsa-miR-543	CLIP-seq
MIRT1552782	hsa-miR-548g	CLIP-seq
MIRT1552784	hsa-miR-628-3p	CLIP-seq
MIRT1552786	hsa-miR-767-5p	CLIP-seq
MIRT1552787	hsa-miR-802	CLIP-seq
MIRT1552749	hsa-miR-142-5p	CLIP-seq
MIRT2604993	hsa-miR-205	CLIP-seq
MIRT1552752	hsa-miR-29a	CLIP-seq
MIRT1552753	hsa-miR-29b	CLIP-seq
MIRT1552754	hsa-miR-29c	CLIP-seq
MIRT2604994	hsa-miR-3124-3p	CLIP-seq
MIRT1552756	hsa-miR-3143	CLIP-seq
MIRT1552757	hsa-miR-325	CLIP-seq
MIRT1552762	hsa-miR-371b-5p	CLIP-seq
MIRT2432346	hsa-miR-4310	CLIP-seq
MIRT1552774	hsa-miR-4766-5p	CLIP-seq
MIRT2604995	hsa-miR-511	CLIP-seq
MIRT1552779	hsa-miR-543	CLIP-seq
MIRT1552782	hsa-miR-548g	CLIP-seq
MIRT1552784	hsa-miR-628-3p	CLIP-seq
MIRT1552786	hsa-miR-767-5p	CLIP-seq
MIRT1552787	hsa-miR-802	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001550	Process	Ovarian cumulus expansion	IEA
GO:0001849	Function	Complement component C1q complex binding	IBA
GO:0001849	Function	Complement component C1q complex binding	IDA	23544079
GO:0001872	Function	(1->3)-beta-D-glucan binding	IEA
GO:0001878	Process	Response to yeast	IEA
GO:0002376	Process	Immune system process	IEA
GO:0005515	Function	Protein binding	IPI	19050261, 19632990, 20363749, 21490156, 22267482, 22786770, 28533443, 29374201, 35102342
GO:0005576	Component	Extracellular region	IEA
GO:0005576	Component	Extracellular region	TAS	1429570
GO:0005615	Component	Extracellular space	IBA
GO:0005615	Component	Extracellular space	IDA	23544079
GO:0006954	Process	Inflammatory response	TAS	1429570
GO:0006955	Process	Immune response	IEA
GO:0008228	Process	Opsonization	IEA
GO:0030198	Process	Extracellular matrix organization	IEA
GO:0031012	Component	Extracellular matrix	IEA
GO:0035580	Component	Specific granule lumen	TAS
GO:0042802	Function	Identical protein binding	IPI	20363749
GO:0044793	Process	Host-mediated suppression of viral proces	IBA
GO:0044871	Process	Negative regulation by host of viral glycoprotein metabolic process	IDA	23544079
GO:0045087	Process	Innate immune response	IBA
GO:0045087	Process	Innate immune response	IDA	23544079
GO:0045429	Process	Positive regulation of nitric oxide biosynthetic process	IEA
GO:0046597	Process	Host-mediated suppression of symbiont invasion	IDA	23544079
GO:0046790	Function	Virion binding	IDA	23544079
GO:0050766	Process	Positive regulation of phagocytosis	IEA
GO:0051707	Process	Response to other organism	IEA
GO:1903019	Process	Negative regulation of glycoprotein metabolic process	IDA	23544079
GO:1904724	Component	Tertiary granule lumen	TAS

Other IDs

• MIM: 602492
• HGNC: 9692
• e!Ensembl: ENSG00000163661

Protein

• UniProt ID: P26022
• Protein name: Pentraxin-related protein PTX3 (Pentaxin-related protein PTX3) (Tumor necrosis factor alpha-induced protein 5) (TNF alpha-induced protein 5) (Tumor necrosis factor-inducible gene 14 protein) (TSG-14)
• Protein function: Plays a role in the regulation of innate resistance to pathogens, inflammatory reactions, possibly clearance of self-components and female fertility.
• PDB: 7ZL1, 8PVQ, 8S50
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00354	Pentaxin	181 → 379	Pentaxin family	Domain

• Sequence:

  MHLLAILFCALWSAVLAENSDDYDLMYVNLDNEIDNGLHPTEDPTPCACGQEHSEWDKLF
  IMLENSQMRERMLLQATDDVLRGELQRLREELGRLAESLARPCAPGAPAEARLTSALDEL
  LQATRDAGRRLARMEGAEAQRPEEAGRALAAVLEELRQTRADLHAVQGWAARSWLPAGCE
  TAILFPMRSKKIFGSVHPVRPMRLESFSACIWVKATDVLNKTILFSYGTKRNPYEIQLYL
  SYQSIVFVVGGEENKLVAEAMVSLGRWTHLCGTWNSEEGLTSLWVNGELAATTVEMATGH
  IVPEGGILQIGQEKNGCCVGGGFDETLAFSGRLTGFNIWDSVLSNEEIRETGGAESCHIR
  GNIVGWGVTEIQPHGGAQYVS

• Sequence length: 381

Pathways

Reactome:

Neutrophil degranulation

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
CYSTIC FIBROSIS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEPRESSED MOOD	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DERMATOLOGIC DISORDERS	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PTX3-related disorder	Uncertain significance; Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PULMONARY FIBROSIS	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SKIN DISEASES	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SKIN DISEASES, GENETIC	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UNIPOLAR DEPRESSION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute Coronary Syndrome	Coronary Syndrome	BEFREE	24709882, 29741292, 31017470, 31147578		★☆☆☆☆ Found in Text Mining only
Acute intermittent porphyria	Intermittent Porphyria	BEFREE	27859020		★☆☆☆☆ Found in Text Mining only
Acute pancreatitis	Pancreatitis	BEFREE	28700471, 29593801, 31798002		★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	28332877		★☆☆☆☆ Found in Text Mining only
Age related macular degeneration	Age-related macular degeneration	BEFREE	26176960, 29374201, 31795454		★☆☆☆☆ Found in Text Mining only
Alveolitis, Fibrosing	Alveolitis	CTD_human_DG	22210019		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	21112127	Associate	★☆☆☆☆ Found in Text Mining only
Amyloidosis	Amyloidosis	BEFREE	22632920		★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	Pubtator	25401491	Associate	★☆☆☆☆ Found in Text Mining only
Anemia Sickle Cell	Sickle cell anemia	Pubtator	23735470	Associate	★☆☆☆☆ Found in Text Mining only
Anemia Sickle Cell	Sickle cell anemia	Pubtator	28436274	Stimulate	★☆☆☆☆ Found in Text Mining only
Anemia, Sickle Cell	Anemia	BEFREE	28436274		★☆☆☆☆ Found in Text Mining only
Aneurysm	Aneurysm	Pubtator	33912155	Associate	★☆☆☆☆ Found in Text Mining only
Angina, Unstable	Intermediate coronary syndrome	BEFREE	17095712, 31066256		★☆☆☆☆ Found in Text Mining only
Angina, Unstable	Intermediate coronary syndrome	LHGDN	17095712		★☆☆☆☆ Found in Text Mining only
Angioedemas Hereditary	Angioedema	Pubtator	26654922	Stimulate	★☆☆☆☆ Found in Text Mining only
Ankylosing spondylitis	Ankylosing Spondylitis	BEFREE	27538101, 28043168		★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Abdominal	Aortic Aneurysm	BEFREE	31703088		★☆☆☆☆ Found in Text Mining only
Aortic Dissection	Aortic dissection	Pubtator	39991758	Associate	★☆☆☆☆ Found in Text Mining only
Appendicitis	Appendicitis	BEFREE	29020470, 30658876		★☆☆☆☆ Found in Text Mining only
Arsenic Encephalopathy	Arsenic Encephalopathy	CTD_human_DG	16835338		★☆☆☆☆ Found in Text Mining only
Arterial Occlusive Diseases	Arterial occlusive disease	Pubtator	23735470	Associate	★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	15262177, 17380301, 18571180, 20656213, 21465531, 23573312, 23690668, 24675235, 25550806, 26138903, 27831642, 29051088, 29742255, 30061319, 30674758, 31615315		★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	23579776, 30718300		★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	10606983, 34248970, 35360114	Associate	★☆☆☆☆ Found in Text Mining only
Arthritis, Gouty	Gouty arthritis	BEFREE	30718300		★☆☆☆☆ Found in Text Mining only
Arthritis, Psoriatic	Psoriatic Arthritis	BEFREE	26138903, 28043168		★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	22529962, 37957139	Associate	★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	BEFREE	27567326		★☆☆☆☆ Found in Text Mining only
Ataxia Telangiectasia	Ataxia telangiectasia	Pubtator	25887408	Associate	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	LHGDN	12006411, 15262177, 17496115		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	15262177, 17380301, 18571180, 20656213, 21465531, 23573312, 23690668, 24675235, 25550806, 26138903, 27831642, 29051088, 29742255, 30061319, 30674758, 31615315		★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	23573312, 24146263, 25550806, 26138903, 32028277, 33413676, 35874788	Associate	★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial Fibrillation	BEFREE	27852958		★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial fibrillation	Pubtator	32028277	Associate	★☆☆☆☆ Found in Text Mining only
Atypical Hemolytic Uremic Syndrome	Hemolytic uremic syndrome	Pubtator	22786770	Associate	★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	16380821, 26287404, 29027216, 29675428, 31383744		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	LHGDN	16380821		★☆☆☆☆ Found in Text Mining only
Bladder Neoplasm	Bladder Neoplasm	BEFREE	31480336		★☆☆☆☆ Found in Text Mining only
Blister	Blister	Pubtator	35874788	Associate	★☆☆☆☆ Found in Text Mining only
Bloom Syndrome	Bloom Syndrome	BEFREE	28526615		★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone disease	Pubtator	27458153, 34248970	Associate	★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone Disease	BEFREE	29022895		★☆☆☆☆ Found in Text Mining only
Brain Ischemia	Brain ischemia	Pubtator	37270727	Associate	★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	26563370	Associate	★☆☆☆☆ Found in Text Mining only
Brain Tumor, Primary	Brain Neoplasms	BEFREE	30942197		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	19794969, 24457902, 26563370, 30740360		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	26563370, 28223411, 32427938, 36555812	Associate	★☆☆☆☆ Found in Text Mining only
Bronchioloalveolar Adenocarcinoma	Lung adenocarcinoma	BEFREE	28071984		★☆☆☆☆ Found in Text Mining only
Cachexia	Cachexia	Pubtator	37712645	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	29306659		★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	31480336		★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	30483742		★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	32345771, 37563650	Stimulate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	36902242	Associate	★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	19164811	Stimulate	★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular Diseases	BEFREE	20656213, 23658833, 23690668, 26138903, 27831642, 27838407, 28332877, 28377191, 28536575, 29051088, 29664315, 29700922, 29783932, 31057548, 31721795		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	21173097, 23658833, 26138903, 26842615, 33413676	Associate	★☆☆☆☆ Found in Text Mining only
Carotid Atherosclerosis	Carotid Atherosclerosis	BEFREE	31615315		★☆☆☆☆ Found in Text Mining only
Cataract	Cataract	BEFREE	28574494		★☆☆☆☆ Found in Text Mining only
CATARACT, ANTERIOR POLAR	Cataract	BEFREE	29964232, 30557448		★☆☆☆☆ Found in Text Mining only
Central Nervous System Diseases	Central nervous system disease	Pubtator	27344170	Associate	★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	29949524, 30315331, 31017470		★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	27377307		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	27377307, 30129088		★☆☆☆☆ Found in Text Mining only
Childhood Acute Lymphoblastic Leukemia	Lymphoblastic Leukemia	BEFREE	23182707		★☆☆☆☆ Found in Text Mining only
Chronic Disease	Chronic disease	Pubtator	19164811	Associate	★☆☆☆☆ Found in Text Mining only
Chronic kidney disease stage 5	Kidney Disease	BEFREE	31316299		★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	BEFREE	23658833, 27838804, 28733767, 29783932, 30319631		★☆☆☆☆ Found in Text Mining only
Chronic Liver Failure	Liver failure	BEFREE	28809733		★☆☆☆☆ Found in Text Mining only
Chronic myeloproliferative disorder	Myeloproliferative disorder	BEFREE	28228104, 28669446		★☆☆☆☆ Found in Text Mining only
Chronic Obstructive Airway Disease	Chronic Obstructive Pulmonary Disease	BEFREE	21920889, 28458531, 29020397, 30572222		★☆☆☆☆ Found in Text Mining only
Chronic Periodontitis	Periodontitis	BEFREE	28643381		★☆☆☆☆ Found in Text Mining only
Cognition Disorders	Cognition disorder	Pubtator	31808814	Inhibit	★☆☆☆☆ Found in Text Mining only
Cognitive Dysfunction	Cognition disorder	Pubtator	31808814	Stimulate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	25679762, 28811977, 30290589		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	27568661, 37511338	Associate	★☆☆☆☆ Found in Text Mining only
Complement Factor H Deficiency	Complement component deficiency	Pubtator	26176960	Associate	★☆☆☆☆ Found in Text Mining only
Congenital heart disease	Congenital Heart Disease	BEFREE	27838407		★☆☆☆☆ Found in Text Mining only
Congestive heart failure	Congestive Heart Failure	BEFREE	23372656, 31105751		★☆☆☆☆ Found in Text Mining only
Conn Syndrome	Conn Syndrome	BEFREE	29715313		★☆☆☆☆ Found in Text Mining only
Corneal Diseases	Corneal disease	Pubtator	33373496	Associate	★☆☆☆☆ Found in Text Mining only
Coronary Aneurysm	Coronary aneurysm	Pubtator	33912155	Associate	★☆☆☆☆ Found in Text Mining only
Coronary Arteriosclerosis	Coronary Arteriosclerosis	BEFREE	22577258, 27778191, 28778748, 28946774, 30954865		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	22577258, 27778191, 28778748, 28946774, 29742255, 29789902, 30954865, 31464731		★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	Pubtator	33912155	Associate	★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	22577258, 27778191, 28778748, 28946774, 30954865		★☆☆☆☆ Found in Text Mining only
Coronary Stenosis	Coronary Stenosis	BEFREE	28778748		★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	39519095	Associate	★☆☆☆☆ Found in Text Mining only
Cystic Fibrosis	Cystic Fibrosis	BEFREE	20927127		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cystic Fibrosis	Cystic fibrosis	Pubtator	20927127, 22834944	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cystic Fibrosis	Cystic fibrosis	Pubtator	23516586	Inhibit	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cystitis	Cystitis	BEFREE	24745336		★☆☆☆☆ Found in Text Mining only
Degenerative polyarthritis	Arthritis	BEFREE	10606983		★☆☆☆☆ Found in Text Mining only
Dermatologic disorders	Dermatologic Disorders	CTD_human_DG	16835338		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dermatomyositis	Dermatomyositis	Pubtator	37280166	Inhibit	★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	28238190, 29715313, 30036122		★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Gestational diabetes	Pubtator	26842615	Inhibit	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	28238190, 28574494, 29715313, 29789902, 30036122		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	28739185, 34128842	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	28119515, 35883173	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Neonatal, with Congenital Hypothyroidism	Diabetes Mellitus With Congenital Hypothyroidism	BEFREE	30411809		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	28119515, 28238190, 29731826, 29881277, 30061319		★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathies	Diabetic neuropathy	Pubtator	28119515	Associate	★☆☆☆☆ Found in Text Mining only
Diabetic Nephropathy	Diabetic Nephropathy	BEFREE	28119515, 29725602, 30476916, 31780874		★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic Retinopathy	BEFREE	28574494, 29961608, 30036122		★☆☆☆☆ Found in Text Mining only
Diabetic Retinopathy	Diabetic retinopathy	Pubtator	35577071	Associate	★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	Pubtator	26842615	Associate	★☆☆☆☆ Found in Text Mining only
Dyslipidemias	Dyslipidemias	BEFREE	28489600		★☆☆☆☆ Found in Text Mining only
Encephalitis	Encephalitis	LHGDN	17441979		★☆☆☆☆ Found in Text Mining only
Encephalitis	Encephalitis	BEFREE	29306404		★☆☆☆☆ Found in Text Mining only
End Stage Liver Disease	End Stage Liver Disease	BEFREE	28809733		★☆☆☆☆ Found in Text Mining only
Endometrial Neoplasms	Endometrial neoplasm	Pubtator	34195683	Associate	★☆☆☆☆ Found in Text Mining only
Endometriosis	Endometriosis	Pubtator	39497588	Associate	★☆☆☆☆ Found in Text Mining only
Eosinophilia, Tropical	Eosinophilia	BEFREE	27567326		★☆☆☆☆ Found in Text Mining only
Epilepsies Myoclonic	Myoclonic epilepsy	Pubtator	27344170	Associate	★☆☆☆☆ Found in Text Mining only
Erectile dysfunction	Erectile Dysfunction	BEFREE	29681053		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	27893424	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	22072855	Inhibit	★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	BEFREE	31264920		★☆☆☆☆ Found in Text Mining only
Essential Hypertension	Hypertension	Pubtator	34128842	Associate	★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty liver	Pubtator	37657050	Associate	★☆☆☆☆ Found in Text Mining only
Fibrosarcoma	Fibrosarcoma	BEFREE	30443492, 31533326		★☆☆☆☆ Found in Text Mining only
Giant Cell Arteritis	Giant cell arteritis	Pubtator	21989653	Associate	★☆☆☆☆ Found in Text Mining only
Giant Cell Arteritis	Giant Cell Arteritis	BEFREE	31573481		★☆☆☆☆ Found in Text Mining only
Giant Cell Arteritis	Giant cell arteritis	Pubtator	31573481	Stimulate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	24503185, 35855654	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	38359612	Stimulate	★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	23664694, 27278519		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	30942197, 36153549, 36647288, 37063077, 37439825, 40656950	Associate	★☆☆☆☆ Found in Text Mining only
Glomerulonephritis	Glomerulonephritis	Pubtator	26027989	Associate	★☆☆☆☆ Found in Text Mining only
Granulomatosis with polyangiitis	Granulomatosis With Polyangiitis	BEFREE	31610684		★☆☆☆☆ Found in Text Mining only
Graves Ophthalmopathy	Graves ophthalmopathy	Pubtator	29675428	Stimulate	★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	25797258		★☆☆☆☆ Found in Text Mining only
Head and Neck Neoplasms	Head and neck neoplasm	Pubtator	34344926	Associate	★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	BEFREE	23372656, 31105751		★☆☆☆☆ Found in Text Mining only
Hematuria	Hematuria	Pubtator	26817892	Stimulate	★☆☆☆☆ Found in Text Mining only
Hereditary hemorrhagic telangiectasia	Hereditary Hemorrhagic Telangiectasia	BEFREE	30329172		★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	BEFREE	21439852, 27915246, 29664315, 30952879		★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	21439852, 27915246, 29664315, 30952879		★☆☆☆☆ Found in Text Mining only
Hyperemia	Hyperemia	BEFREE	30411809		★☆☆☆☆ Found in Text Mining only
Hyperglycemia	Hyperglycemia	BEFREE	29715313		★☆☆☆☆ Found in Text Mining only
Hyperoxaluria	Hyperoxaluria	BEFREE	30319631		★☆☆☆☆ Found in Text Mining only
Hypertensive disease	Hypertension	BEFREE	27838407, 27838804, 28332877, 29700922, 29789902, 30411809, 31264920, 31331488		★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	20151982	Stimulate	★☆☆☆☆ Found in Text Mining only
Idiopathic pulmonary arterial hypertension	Pulmonary arterial hypertension	BEFREE	27838407		★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	22822025		★☆☆☆☆ Found in Text Mining only
IGA Glomerulonephritis	Glomerulonephritis	LHGDN	12538709		★☆☆☆☆ Found in Text Mining only
Immunologic Deficiency Syndromes	Immunologic Deficiency Syndromes	BEFREE	21764903		★☆☆☆☆ Found in Text Mining only
Impaired cognition	Impaired Cognition	BEFREE	31808814		★☆☆☆☆ Found in Text Mining only
Incontinentia Pigmenti Achromians	Incontinentia Pigmenti Achromians	BEFREE	29020397		★☆☆☆☆ Found in Text Mining only
Infertility	Infertility	Pubtator	39497588	Associate	★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	35059041	Associate	★☆☆☆☆ Found in Text Mining only
Ischemic stroke	Ischemic Stroke	BEFREE	28601054, 29949524, 30315331		★☆☆☆☆ Found in Text Mining only
Juvenile arthritis	Arthritis	BEFREE	23579776		★☆☆☆☆ Found in Text Mining only
Kaposi Sarcoma	Kaposi Sarcoma	LHGDN	12004288		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney Disease	LHGDN	18417746		★☆☆☆☆ Found in Text Mining only
Kidney Diseases	Kidney disease	Pubtator	31780874	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Failure Chronic	Kidney failure	Pubtator	34285273	Associate	★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	29672566		★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	LHGDN	17786277		★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	BEFREE	31316299		★☆☆☆☆ Found in Text Mining only
Leprosy	Leprosy	Pubtator	38053036	Stimulate	★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	29202702		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	29202702	Associate	★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	31334115		★☆☆☆☆ Found in Text Mining only
liposarcoma	Liposarcoma	BEFREE	16959485		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	26400151, 30087705		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis	Liver Cirrhosis	BEFREE	28809733, 30087705		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	26348770, 30483742	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	32587638	Stimulate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus	Lupus Erythematosus	BEFREE	27405845		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	25401491	Stimulate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	28257596, 31137925	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Discoid	Lupus Erythematosus	BEFREE	27405845		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	27405845, 28257596, 28420068, 30740098, 31191526, 31599644		★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus nephritis	Pubtator	26817892	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus Nephritis	BEFREE	27405845, 28393653, 30740098, 31317585		★☆☆☆☆ Found in Text Mining only
Lupus Vulgaris	Lupus Vulgaris	BEFREE	27405845		★☆☆☆☆ Found in Text Mining only
Lymphedema	Lymphedema	Pubtator	38111581	Stimulate	★☆☆☆☆ Found in Text Mining only
Macular Degeneration	Macular degeneration	Pubtator	26176960, 29374201, 31795454	Associate	★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	14603263		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Major Depressive Disorder	Mental Depression	PSYGENET_DG	14603263		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	25797258		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	19794969, 24457902, 26563370, 28223411, 30740360		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	30483742		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	31334115		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	29137286		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	25964543		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	31480336		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	23573312, 23664694, 24457902, 25679762, 25797258, 26124179, 26267536, 27278519, 27377307, 27862647, 28393357, 28811977, 29175552, 29412047, 30290589, 30483742, 30628067, 30942197, 31019517, 31334115		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	27377307		★☆☆☆☆ Found in Text Mining only
Malnutrition	Malnutrition	BEFREE	31316299		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	28223415		★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	24130051, 31253871		★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	BEFREE	28327132, 30942197		★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	Pubtator	28327132	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome	Metabolic syndrome	Pubtator	21900125	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	21900125, 30674758, 31560233		★☆☆☆☆ Found in Text Mining only
Migraine Disorders	Migraine	BEFREE	25604633, 28677995, 30961918		★☆☆☆☆ Found in Text Mining only
Migraine Disorders	Migraine	Pubtator	35895308	Stimulate	★☆☆☆☆ Found in Text Mining only
Mitral Valve Stenosis	Mitral Valve Stenosis	BEFREE	26576501		★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	BEFREE	24964229, 29913529		★☆☆☆☆ Found in Text Mining only
Mucocutaneous Lymph Node Syndrome	Kawasaki disease	Pubtator	33912155	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	26576501		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	BEFREE	15262177, 23285251, 28216633, 31017470		★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	23285251, 31772617	Associate	★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial infarction	Pubtator	24737925	Stimulate	★☆☆☆☆ Found in Text Mining only
Myositis	Myositis	Pubtator	37280166	Associate	★☆☆☆☆ Found in Text Mining only
Necrosis	Necrosis	Pubtator	22511625	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	19794969, 21489226, 21764903, 22072855, 23664694, 24130051, 24457902, 25679762, 25797258, 25964543, 26124179, 26267536, 27278519, 27377307, 27862647, 28223415, 28489600, 29137286, 29175552, 30087705, 30443492, 30942197, 31487962		★☆☆☆☆ Found in Text Mining only
Nephritis	Nephritis	BEFREE	27405845		★☆☆☆☆ Found in Text Mining only
Nephritis Interstitial	Interstitial nephritis	Pubtator	26817892	Associate	★☆☆☆☆ Found in Text Mining only
Nephrotic Syndrome	Nephrotic syndrome	Pubtator	26817892	Stimulate	★☆☆☆☆ Found in Text Mining only
nervous system disorder	Nervous System Disorder	BEFREE	26576501		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	38063204	Associate	★☆☆☆☆ Found in Text Mining only
Neuromyelitis Optica	Neuromyelitis Optica	BEFREE	28281110		★☆☆☆☆ Found in Text Mining only
Non-alcoholic Fatty Liver Disease	Non-Alcoholic Fatty Liver Disease	BEFREE	27831642		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	21900125, 24415446, 27831642, 28298172, 28400677, 28440716, 28770376, 30105036, 30674758, 30859179		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	21900125, 34507654, 35317787	Associate	★☆☆☆☆ Found in Text Mining only
Optic Neuropathy Ischemic	Optic neuropathy	Pubtator	21989653	Associate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	33931080	Stimulate	★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	34208590	Associate	★☆☆☆☆ Found in Text Mining only
Osteolysis	Osteolysis	Pubtator	27458153	Associate	★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	BEFREE	29022895		★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	29022895	Associate	★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	33931080	Stimulate	★☆☆☆☆ Found in Text Mining only
Ovarian Diseases	Ovarian diseases	Pubtator	22633261	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	23828517, 25409614	Associate	★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	BEFREE	11724911		★☆☆☆☆ Found in Text Mining only
Periodontal Diseases	Periodontal Diseases	BEFREE	27734498, 28643381		★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	BEFREE	28643381, 30417380, 31111284, 31583485, 31787987		★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	Pubtator	35360114	Associate	★☆☆☆☆ Found in Text Mining only
Peripheral Arterial Disease	Peripheral arterial disease	Pubtator	22123215	Associate	★☆☆☆☆ Found in Text Mining only
Peripheral Arterial Diseases	Vascular Diseases	BEFREE	27734498, 30249941		★☆☆☆☆ Found in Text Mining only
Peyronie Disease	Peyronie Disease	BEFREE	28359407		★☆☆☆☆ Found in Text Mining only
Piebaldism	Piebaldism	BEFREE	30942197		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic Ovary Syndrome	BEFREE	24279306, 31282210		★☆☆☆☆ Found in Text Mining only
Polycystic Ovary Syndrome	Polycystic ovary syndrome	Pubtator	24279306, 37930517, 38167474	Associate	★☆☆☆☆ Found in Text Mining only
Polycythemia Vera	Polycythemia Vera	BEFREE	21173097, 28228104		★☆☆☆☆ Found in Text Mining only
Polycythemia Vera	Polycythemia vera	Pubtator	21173097, 28228104	Associate	★☆☆☆☆ Found in Text Mining only
Precursor B-cell lymphoblastic leukemia	Lymphoblastic Leukemia	BEFREE	25323314		★☆☆☆☆ Found in Text Mining only
Primary Graft Dysfunction	Primary graft dysfunction	Pubtator	22822025, 27421969	Associate	★☆☆☆☆ Found in Text Mining only
Proliferative vitreoretinopathy	Proliferative Vitreoretinopathy	BEFREE	28252047		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	29137286		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	BEFREE	30827759		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	33110136, 39187920	Associate	★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	LHGDN	16865225		★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	21920889	Inhibit	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	28458531	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	CTD_human_DG	22210019		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Purpura, Thrombotic Thrombocytopenic	Thrombotic thrombocytopenic purpura	BEFREE	30858847		★☆☆☆☆ Found in Text Mining only
Pyelonephritis	Pyelonephritis	BEFREE	30796728		★☆☆☆☆ Found in Text Mining only
Raynaud Phenomenon	Raynaud Phenomenon	BEFREE	28420068		★☆☆☆☆ Found in Text Mining only
Renal fibrosis	Renal fibrosis	BEFREE	31316299		★☆☆☆☆ Found in Text Mining only
Respiratory Tract Infections	Respiratory system infectious disease	Pubtator	33906523	Associate	★☆☆☆☆ Found in Text Mining only
Retinal Diseases	Retinal Diseases	BEFREE	30036122		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	10606983, 21345291, 27973973, 28225768, 29408170, 31191526, 31601476, 31615315		★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	BEFREE	30443492		★☆☆☆☆ Found in Text Mining only
Sepsis	Sepsis	Pubtator	28458531	Stimulate	★☆☆☆☆ Found in Text Mining only
Septicemia	Septicemia	BEFREE	11404378, 27864924, 28793880, 28965650, 29174966, 29435167, 30687307, 31031772, 31489646, 31718563		★☆☆☆☆ Found in Text Mining only
Severe periodontitis	Periodontitis	BEFREE	31111284		★☆☆☆☆ Found in Text Mining only
Skin lesion	Skin Lesion	BEFREE	29272525		★☆☆☆☆ Found in Text Mining only
Sleep Apnea Obstructive	Sleep apnea	Pubtator	25237185	Associate	★☆☆☆☆ Found in Text Mining only
Sleep Apnea, Obstructive	Sleep Apnea	BEFREE	28960823		★☆☆☆☆ Found in Text Mining only
Small Cell Lung Carcinoma	Small cell lung carcinoma	Pubtator	32587638	Stimulate	★☆☆☆☆ Found in Text Mining only
Spondylarthritis	Spondyloarthritis	BEFREE	28043168		★☆☆☆☆ Found in Text Mining only
Spondylitis Ankylosing	Ankylosing spondylitis	Pubtator	27538101	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of esophagus	Esophagus Neoplasm	BEFREE	22072855, 27625097		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	33526991, 34917682	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	25797258, 28489600		★☆☆☆☆ Found in Text Mining only
ST segment elevation myocardial infarction	ST Segment Elevation Myocardial Infarction	BEFREE	31782880, 31799884, 31828271		★☆☆☆☆ Found in Text Mining only
Stable angina	Stable Angina	BEFREE	29789902, 31805452		★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	25964543		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	27458153, 35854776	Associate	★☆☆☆☆ Found in Text Mining only
Systemic Scleroderma	Scleroderma	BEFREE	19794969, 20506099, 27878407		★☆☆☆☆ Found in Text Mining only
Takayasu Arteritis	Takayasu Arteritis	BEFREE	24548718, 28968895, 30943132, 31191526, 31264920, 31573481		★☆☆☆☆ Found in Text Mining only
Thrombocythemia Essential	Essential thrombocythemia	Pubtator	21173097, 28228104, 31801935	Associate	★☆☆☆☆ Found in Text Mining only
Thrombocythemia, Essential	Thrombocythemia	BEFREE	21173097, 28228104		★☆☆☆☆ Found in Text Mining only
Thrombosis	Thrombosis	Pubtator	21173097	Inhibit	★☆☆☆☆ Found in Text Mining only
Thrombotic Microangiopathies	Thrombotic Microangiopathies	BEFREE	30858847		★☆☆☆☆ Found in Text Mining only
Thyroid associated opthalmopathies	Thyroid eye disease	BEFREE	29675428		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasms	Thyroid cancer	Pubtator	37705974	Associate	★☆☆☆☆ Found in Text Mining only
Trichohepatoenteric Syndrome	Trichohepatoenteric Syndrome	BEFREE	28960823		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	35090088	Associate	★☆☆☆☆ Found in Text Mining only
Ulcerative Colitis	Ulcerative colitis	BEFREE	27610713		★☆☆☆☆ Found in Text Mining only
Unipolar Depression	Mental Depression	BEFREE	14603263		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Unipolar Depression	Mental Depression	PSYGENET_DG	14603263		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uremia	Uremia	BEFREE	23658833, 30557448		★☆☆☆☆ Found in Text Mining only
Uremia	Uremia	Pubtator	23658833	Associate	★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	LHGDN	12006390		★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	23658833	Stimulate	★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	25550806, 26138903, 27915246, 33413676	Associate	★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular Diseases	BEFREE	29715313		★☆☆☆☆ Found in Text Mining only
Vascular System Injuries	Vascular system injury	Pubtator	25401491, 27915246	Associate	★☆☆☆☆ Found in Text Mining only
Vasculitis	Vasculitis	BEFREE	24964229, 28420068, 28850023, 31264920		★☆☆☆☆ Found in Text Mining only
Vasculitis	Vasculitis	Pubtator	25401491, 31573481	Associate	★☆☆☆☆ Found in Text Mining only
Vasculitis	Vasculitis	Pubtator	32734361	Stimulate	★☆☆☆☆ Found in Text Mining only
Vasculitis of large artery	Vasculitis	BEFREE	31191526, 31573481		★☆☆☆☆ Found in Text Mining only
Vasculitis of the skin	Vasculitis	BEFREE	28420068		★☆☆☆☆ Found in Text Mining only
Ventricular Dysfunction Left	Ventricular dysfunction	Pubtator	21448138, 39375631	Associate	★☆☆☆☆ Found in Text Mining only
Vesico-Ureteral Reflux	Vesicoureteral Reflux	BEFREE	30796728		★☆☆☆☆ Found in Text Mining only
Vesicoureteral Reflux 1	Vesicoureteral Reflux	BEFREE	30796728		★☆☆☆☆ Found in Text Mining only