PTPRZ1 (protein tyrosine phosphatase receptor type Z1)

Gene

• Entrez ID: 5803
• Gene name: Protein tyrosine phosphatase receptor type Z1
• Gene symbol: PTPRZ1
• Synonyms (NCBI Gene): HPTPZ, HPTPzeta, PTP-ZETA, PTP18, PTPRZ, PTPZ, R-PTP-zeta-2, RPTPB, RPTPbeta, phosphacan
• Chromosome: 7
• Chromosome location: 7q31.32
• Summary: This gene encodes a member of the receptor protein tyrosine phosphatase family. Expression of this gene is restricted to the central nervous system (CNS), and it may be involved in the regulation of specific developmental processes in the CNS. Alternative

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT022444	hsa-miR-124-3p	Microarray	18668037
MIRT025060	hsa-miR-181a-5p	Microarray	17612493
MIRT053463	hsa-miR-200c-3p	Microarray	23807165
MIRT1276598	hsa-miR-3529	CLIP-seq
MIRT1276599	hsa-miR-3667-5p	CLIP-seq
MIRT1276600	hsa-miR-379	CLIP-seq
MIRT1276601	hsa-miR-4451	CLIP-seq
MIRT1276602	hsa-miR-4650-3p	CLIP-seq
MIRT1276603	hsa-miR-548a-3p	CLIP-seq
MIRT1276604	hsa-miR-548e	CLIP-seq
MIRT1276605	hsa-miR-548f	CLIP-seq
MIRT1276606	hsa-miR-582-3p	CLIP-seq
MIRT1276607	hsa-miR-125a-3p	CLIP-seq
MIRT1276608	hsa-miR-3150a-5p	CLIP-seq
MIRT1276609	hsa-miR-3150b-5p	CLIP-seq
MIRT1276610	hsa-miR-3673	CLIP-seq
MIRT1276611	hsa-miR-3692	CLIP-seq
MIRT1276612	hsa-miR-3934	CLIP-seq
MIRT1276613	hsa-miR-4678	CLIP-seq
MIRT1276614	hsa-miR-4693-5p	CLIP-seq
MIRT1276615	hsa-miR-4703-3p	CLIP-seq
MIRT1276616	hsa-miR-493	CLIP-seq
MIRT1276617	hsa-miR-764	CLIP-seq
MIRT2081329	hsa-miR-133a	CLIP-seq
MIRT2081330	hsa-miR-133b	CLIP-seq
MIRT2081331	hsa-miR-3117-5p	CLIP-seq
MIRT2081332	hsa-miR-4704-5p	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
ELK1	Unknown	20224786
EPAS1	Unknown	20224786

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002244	Process	Hematopoietic progenitor cell differentiation	IEA
GO:0004721	Function	Phosphoprotein phosphatase activity	IEA
GO:0004725	Function	Protein tyrosine phosphatase activity	IBA
GO:0004725	Function	Protein tyrosine phosphatase activity	IDA	10706604
GO:0004725	Function	Protein tyrosine phosphatase activity	IEA
GO:0004725	Function	Protein tyrosine phosphatase activity	ISS
GO:0004725	Function	Protein tyrosine phosphatase activity	TAS
GO:0005001	Function	Transmembrane receptor protein tyrosine phosphatase activity	IEA
GO:0005001	Function	Transmembrane receptor protein tyrosine phosphatase activity	TAS	1323835
GO:0005178	Function	Integrin binding	IDA	19141530
GO:0005515	Function	Protein binding	IPI	10706604, 17681947, 19141530, 21969550
GO:0005576	Component	Extracellular region	IEA
GO:0005886	Component	Plasma membrane	IDA	19141530
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	ISS
GO:0005886	Component	Plasma membrane	TAS	8387522
GO:0006470	Process	Protein dephosphorylation	TAS	1323835
GO:0007165	Process	Signal transduction	IBA
GO:0007409	Process	Axonogenesis	IEA
GO:0007417	Process	Central nervous system development	IEA
GO:0007417	Process	Central nervous system development	TAS	8387522
GO:0007611	Process	Learning or memory	IEA
GO:0007611	Process	Learning or memory	ISS
GO:0016020	Component	Membrane	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0031012	Component	Extracellular matrix	IEA
GO:0031175	Process	Neuron projection development	IBA
GO:0031641	Process	Regulation of myelination	IEA
GO:0031641	Process	Regulation of myelination	ISS
GO:0035335	Process	Peptidyl-tyrosine dephosphorylation	ISS
GO:0043524	Process	Negative regulation of neuron apoptotic process	IEA
GO:0043524	Process	Negative regulation of neuron apoptotic process	ISS
GO:0045202	Component	Synapse	IEA
GO:0048709	Process	Oligodendrocyte differentiation	IBA
GO:0048709	Process	Oligodendrocyte differentiation	IEA
GO:0048709	Process	Oligodendrocyte differentiation	ISS
GO:0048714	Process	Positive regulation of oligodendrocyte differentiation	ISS
GO:0070445	Process	Regulation of oligodendrocyte progenitor proliferation	IEA
GO:0070445	Process	Regulation of oligodendrocyte progenitor proliferation	ISS
GO:0072534	Component	Perineuronal net	IEA

Other IDs

• MIM: 176891
• HGNC: 9685
• e!Ensembl: ENSG00000106278

Protein

• UniProt ID: P23471
• Protein name: Receptor-type tyrosine-protein phosphatase zeta (R-PTP-zeta) (EC 3.1.3.48) (Protein-tyrosine phosphatase receptor type Z polypeptide 1) (Protein-tyrosine phosphatase receptor type Z polypeptide 2) (R-PTP-zeta-2)
• Protein function: Protein tyrosine phosphatase that negatively regulates oligodendrocyte precursor proliferation in the embryonic spinal cord. Required for normal differentiation of the precursor cells into mature, fully myelinating oligodendrocytes. May play a r
• PDB: 3JXF, 3S97, 5AWX, 5H08, 8FN8, 8FN9
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00194	Carb_anhydrase	37 → 299	Eukaryotic-type carbonic anhydrase	Domain
  PF00041	fn3	313 → 401	Fibronectin type III domain	Domain
  PF00102	Y_phosphatase	1750 → 1991	Protein-tyrosine phosphatase	Domain
  PF00102	Y_phosphatase	2048 → 2281	Protein-tyrosine phosphatase	Domain

• Tissue specificity: TISSUE SPECIFICITY: Specifically expressed in the central nervous system, where it is localized in the Purkinje cell layer of the cerebellum, the dentate gyrus, and the subependymal layer of the anterior horn of the lateral ventricle. Developmentally regu
• Sequence:

  MRILKRFLACIQLLCVCRLDWANGYYRQQRKLVEEIGWSYTGALNQKNWGKKYPTCNSPK
  QSPINIDEDLTQVNVNLKKLKFQGWDKTSLENTFIHNTGKTVEINLTNDYRVSGGVSEMV
  FKASKITFHWGKCNMSSDGSEHSLEGQKFPLEMQIYCFDADRFSSFEEAVKGKGKLRALS
  ILFEVGTEENLDFKAIIDGVESVSRFGKQAALDPFILLNLLPNSTDKYYIYNGSLTSPPC
  TDTVDWIVFKDTVSISESQLAVFCEVLTMQQSGYVMLMDYLQNNFREQQYKFSRQVFSSY
  TGKEEIHEAVCSSEPENVQADPENYTSLLVTWERPRVVYDTMIEKFAVLYQQLDGEDQTK
  HEFLTDGYQDLGAILNNLLPNMSYVLQIVAICTNGLYGKYSDQLIVDMPTDNPELDLFPE
  LIGTEEIIKEEEEGKDIEEGAIVNPGRDSATNQIRKKEPQISTTTHYNRIGTKYNEAKTN
  RSPTRGSEFSGKGDVPNTSLNSTSQPVTKLATEKDISLTSQTVTELPPHTVEGTSASLND
  GSKTVLRSPHMNLSGTAESLNTVSITEYEEESLLTSFKLDTGAEDSSGSSPATSAIPFIS
  ENISQGYIFSSENPETITYDVLIPESARNASEDSTSSGSEESLKDPSMEGNVWFPSSTDI
  TAQPDVGSGRESFLQTNYTEIRVDESEKTTKSFSAGPVMSQGPSVTDLEMPHYSTFAYFP
  TEVTPHAFTPSSRQQDLVSTVNVVYSQTTQPVYNGETPLQPSYSSEVFPLVTPLLLDNQI
  LNTTPAASSSDSALHATPVFPSVDVSFESILSSYDGAPLLPFSSASFSSELFRHLHTVSQ
  ILPQVTSATESDKVPLHASLPVAGGDLLLEPSLAQYSDVLSTTHAASETLEFGSESGVLY
  KTLMFSQVEPPSSDAMMHARSSGPEPSYALSDNEGSQHIFTVSYSSAIPVHDSVGVTYQG
  SLFSGPSHIPIPKSSLITPTASLLQPTHALSGDGEWSGASSDSEFLLPDTDGLTALNISS
  PVSVAEFTYTTSVFGDDNKALSKSEIIYGNETELQIPSFNEMVYPSESTVMPNMYDNVNK
  LNASLQETSVSISSTKGMFPGSLAHTTTKVFDHEISQVPENNFSVQPTHTVSQASGDTSL
  KPVLSANSEPASSDPASSEMLSPSTQLLFYETSASFSTEVLLQPSFQASDVDTLLKTVLP
  AVPSDPILVETPKVDKISSTMLHLIVSNSASSENMLHSTSVPVFDVSPTSHMHSASLQGL
  TISYASEKYEPVLLKSESSHQVVPSLYSNDELFQTANLEINQAHPPKGRHVFATPVLSID
  EPLNTLINKLIHSDEILTSTKSSVTGKVFAGIPTVASDTFVSTDHSVPIGNGHVAITAVS
  PHRDGSVTSTKLLFPSKATSELSHSAKSDAGLVGGGEDGDTDDDGDDDDDDRGSDGLSIH
  KCMSCSSYRESQEKVMNDSDTHENSLMDQNNPISYSLSENSEEDNRVTSVSSDSQTGMDR
  SPGKSPSANGLSQKHNDGKEENDIQTGSALLPLSPESKAWAVLTSDEESGSGQGTSDSLN
  ENETSTDFSFADTNEKDADGILAAGDSEITPGFPQSPTSSVTSENSEVFHVSEAEASNSS
  HESRIGLAEGLESEKKAVIPLVIVSALTFICLVVLVGILIYWRKCFQTAHFYLEDSTSPR
  VISTPPTPIFPISDDVGAIPIKHFPKHVADLHASSGFTEEFETLKEFYQEVQSCTVDLGI
  TADSSNHPDNKHKNRYINIVAYDHSRVKLAQLAEKDGKLTDYINANYVDGYNRPKAYIAA
  QGPLKSTAEDFWRMIWEHNVEVIVMITNLVEKGRRKCDQYWPADGSEEYGNFLVTQKSVQ
  VLAYYTVRNFTLRNTKIKKGSQKGRPSGRVVTQYHYTQWPDMGVPEYSLPVLTFVRKAAY
  AKRHAVGPVVVHCSAGVGRTGTYIVLDSMLQQIQHEGTVNIFGFLKHIRSQRNYLVQTEE
  QYVFIHDTLVEAILSKETEVLDSHIHAYVNALLIPGPAGKTKLEKQFQLLSQSNIQQSDY
  SAALKQCNREKNRTSSIIPVERSRVGISSLSGEGTDYINASYIMGYYQSNEFIITQHPLL
  HTIKDFWRMIWDHNAQLVVMIPDGQNMAEDEFVYWPNKDEPINCESFKVTLMAEEHKCLS
  NEEKLIIQDFILEATQDDYVLEVRHFQCPKWPNPDSPISKTFELISVIKEEAANRDGPMI
  VHDEHGGVTAGTFCALTTLMHQLEKENSVDVYQVAKMINLMRPGVFADIEQYQFLYKVIL
  SLVSTRQEENPSTSLDSNGAALPDGNIAESLESLV

• Sequence length: 2315

Pathways

KEGG:

Epithelial cell signaling in Helicobacter pylori infection

Reactome:

Other interleukin signaling

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
Cervical cancer	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEMENTIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
High myopia	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MALIGNANT EPITHELIAL TUMOR OF OVARY	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Uncertain significance; Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SEVERE MYOPIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Spastic paraparesis	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uveal melanoma	Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenocarcinoma	Adenocarcinoma	BEFREE	26851024		★☆☆☆☆ Found in Text Mining only
Adult Oligodendroglioma	Oligodendroglioma	BEFREE	29308320		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	26950848	Associate	★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety Disorder	BEFREE	28025742		★☆☆☆☆ Found in Text Mining only
Anxiety	Anxiety disorder	Pubtator	38051303	Associate	★☆☆☆☆ Found in Text Mining only
Anxiety Disorders	Anxiety Disorder	BEFREE	28025742		★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	15831233		★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	Pubtator	15831233, 23349846, 27586084, 31381204, 36503484	Associate	★☆☆☆☆ Found in Text Mining only
Autistic Disorder	Autism	BEFREE	15523497, 15998549		★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	34812554	Associate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	17706593, 30497491	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoid Tumor	Carcinoid tumor	Pubtator	38237798	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Ductal	Ductal carcinoma	Pubtator	17706593	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Ovarian Epithelial	Epithelial ovarian carcinoma	Pubtator	25418856	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	25418856		★☆☆☆☆ Found in Text Mining only
Childhood Oligodendroglioma	Oligodendroglioma	BEFREE	29308320		★☆☆☆☆ Found in Text Mining only
CNS disorder	CNS Disorder	BEFREE	29275231		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	10077226, 23096495, 24242166, 26851024		★☆☆☆☆ Found in Text Mining only
Conventional (Clear Cell) Renal Cell Carcinoma	Renal Carcinoma	BEFREE	23588815		★☆☆☆☆ Found in Text Mining only
Epithelial ovarian cancer	Ovarian cancer	BEFREE	25418856		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	1323835, 15831233, 15908427, 16582634, 20235875, 25135958, 27586084, 31381204, 33317554, 35883571, 38167429	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	LHGDN	14555979		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	14692702, 15831233, 16923162, 27586084, 28504721, 28569747, 28717188		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	20224786	Stimulate	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	15831233, 16923162, 28504721, 28569747, 28717188		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	15831233, 16923162, 25238264, 28569747, 28717188		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	25135958, 25935522, 31381204, 33645009, 34812554	Associate	★☆☆☆☆ Found in Text Mining only
Hyperlysinemias	Hyperlipidemia	Pubtator	23570448	Associate	★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory Bowel Disease	BEFREE	27898738		★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	25043478		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	20639902, 34812554	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Nephritis	Lupus Nephritis	BEFREE	30622154		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	25043478		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	25418856		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	14692702, 15831233, 25043478, 28569747, 31205522		★☆☆☆☆ Found in Text Mining only
Malnutrition	Malnutrition	BEFREE	26360410		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	17706593		★☆☆☆☆ Found in Text Mining only
Meningioma	Meningioma	Pubtator	20235875, 32968068	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	20574050	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	15831233, 16923162, 25043478, 25238264, 26360410, 31381204		★☆☆☆☆ Found in Text Mining only
Neuroendocrine Tumors	Neuroendocrine Tumors	BEFREE	23170925		★☆☆☆☆ Found in Text Mining only
oligodendroglioma	Oligodendroglioma	LHGDN	18003890		★☆☆☆☆ Found in Text Mining only
oligodendroglioma	Oligodendroglioma	BEFREE	29308320		★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	26360410		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	25418856		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	25418856	Associate	★☆☆☆☆ Found in Text Mining only
Pilocytic Astrocytoma	Astrocytoma	BEFREE	31381204		★☆☆☆☆ Found in Text Mining only
Renal Cell Carcinoma	Renal Carcinoma	BEFREE	23588815		★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	17579610, 18186075, 22832403, 28025742		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	PSYGENET_DG	17579610, 18186075, 22832403		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	Pubtator	17579610	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Small cell carcinoma of lung	Lung carcinoma	BEFREE	23170925		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	23226095	Inhibit	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of mouth	Oral cavity carcinoma	BEFREE	25043478		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	LHGDN	16338072		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	30497491		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	30497491	Associate	★☆☆☆☆ Found in Text Mining only
Well Differentiated Oligodendroglioma	Oligodendroglioma	BEFREE	29308320		★☆☆☆☆ Found in Text Mining only