PTPRR (protein tyrosine phosphatase receptor type R)

Gene

• Entrez ID: 5801
• Gene name: Protein tyrosine phosphatase receptor type R
• Gene symbol: PTPRR
• Synonyms (NCBI Gene): EC-PTP, PCPTP1, PTP-SL, PTPBR7, PTPRQ
• Chromosome: 12
• Chromosome location: 12q15
• Summary: The protein encoded by this gene is a member of the protein tyrosine phosphatase (PTP) family. PTPs are known to be signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic tran

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT021209	hsa-miR-150-5p	Microarray	20218812
MIRT1276449	hsa-miR-105	CLIP-seq
MIRT1276450	hsa-miR-1275	CLIP-seq
MIRT1276451	hsa-miR-3190	CLIP-seq
MIRT1276452	hsa-miR-3681	CLIP-seq
MIRT1276453	hsa-miR-4260	CLIP-seq
MIRT1276454	hsa-miR-4491	CLIP-seq
MIRT1276455	hsa-miR-4525	CLIP-seq
MIRT1276456	hsa-miR-4657	CLIP-seq
MIRT1276457	hsa-miR-4665-5p	CLIP-seq
MIRT1276458	hsa-miR-4723-5p	CLIP-seq
MIRT1276459	hsa-miR-520d-5p	CLIP-seq
MIRT1276460	hsa-miR-524-5p	CLIP-seq
MIRT1276461	hsa-miR-625	CLIP-seq
MIRT1276449	hsa-miR-105	CLIP-seq
MIRT1276450	hsa-miR-1275	CLIP-seq
MIRT1276462	hsa-miR-3692	CLIP-seq
MIRT1276453	hsa-miR-4260	CLIP-seq
MIRT1276455	hsa-miR-4525	CLIP-seq
MIRT1276457	hsa-miR-4665-5p	CLIP-seq
MIRT1276458	hsa-miR-4723-5p	CLIP-seq
MIRT1276459	hsa-miR-520d-5p	CLIP-seq
MIRT1276460	hsa-miR-524-5p	CLIP-seq
MIRT1276461	hsa-miR-625	CLIP-seq
MIRT1276449	hsa-miR-105	CLIP-seq
MIRT2307273	hsa-miR-1237	CLIP-seq
MIRT2307274	hsa-miR-1248	CLIP-seq
MIRT1276450	hsa-miR-1275	CLIP-seq
MIRT2307275	hsa-miR-1286	CLIP-seq
MIRT2307276	hsa-miR-4255	CLIP-seq
MIRT1276453	hsa-miR-4260	CLIP-seq
MIRT2307277	hsa-miR-4448	CLIP-seq
MIRT1276455	hsa-miR-4525	CLIP-seq
MIRT2307278	hsa-miR-4663	CLIP-seq
MIRT1276457	hsa-miR-4665-5p	CLIP-seq
MIRT2307279	hsa-miR-4722-5p	CLIP-seq
MIRT1276458	hsa-miR-4723-5p	CLIP-seq
MIRT2307280	hsa-miR-4777-5p	CLIP-seq
MIRT2307281	hsa-miR-518d-5p	CLIP-seq
MIRT2307282	hsa-miR-519b-5p	CLIP-seq
MIRT2307283	hsa-miR-519c-5p	CLIP-seq
MIRT2307284	hsa-miR-520c-5p	CLIP-seq
MIRT1276459	hsa-miR-520d-5p	CLIP-seq
MIRT1276460	hsa-miR-524-5p	CLIP-seq
MIRT2307285	hsa-miR-526a	CLIP-seq
MIRT1276461	hsa-miR-625	CLIP-seq
MIRT2307286	hsa-miR-628-5p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001701	Process	In utero embryonic development	IEP	10601328
GO:0004721	Function	Phosphoprotein phosphatase activity	IEA
GO:0004725	Function	Protein tyrosine phosphatase activity	IBA
GO:0004725	Function	Protein tyrosine phosphatase activity	IEA
GO:0004725	Function	Protein tyrosine phosphatase activity	TAS	7836467
GO:0005001	Function	Transmembrane receptor protein tyrosine phosphatase activity	TAS	7836467
GO:0005515	Function	Protein binding	IPI	10601328, 23932588, 25241761, 28065597, 32296183, 33961781
GO:0005576	Component	Extracellular region	IEA
GO:0005615	Component	Extracellular space	HDA	22664934
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IBA
GO:0005829	Component	Cytosol	IDA
GO:0005886	Component	Plasma membrane	IBA
GO:0005886	Component	Plasma membrane	IDA
GO:0005886	Component	Plasma membrane	IEA
GO:0006470	Process	Protein dephosphorylation	TAS	7836467
GO:0007165	Process	Signal transduction	IBA
GO:0010633	Process	Negative regulation of epithelial cell migration	IMP	21724833
GO:0016020	Component	Membrane	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0019901	Function	Protein kinase binding	IBA
GO:0019901	Function	Protein kinase binding	IEA
GO:0019901	Function	Protein kinase binding	ISS
GO:0030054	Component	Cell junction	IBA
GO:0030054	Component	Cell junction	IDA
GO:0038128	Process	ERBB2 signaling pathway	IMP	21724833
GO:0048471	Component	Perinuclear region of cytoplasm	IEA
GO:0070373	Process	Negative regulation of ERK1 and ERK2 cascade	IMP	21724833
GO:1903385	Process	Regulation of homophilic cell adhesion	IMP	21724833

Other IDs

• MIM: 602853
• HGNC: 9680
• e!Ensembl: ENSG00000153233

Protein

• UniProt ID: Q15256
• Protein name: Receptor-type tyrosine-protein phosphatase R (R-PTP-R) (EC 3.1.3.48) (Ch-1PTPase) (NC-PTPCOM1) (Protein-tyrosine phosphatase PCPTP1)
• Protein function: Sequesters mitogen-activated protein kinases (MAPKs) such as MAPK1, MAPK3 and MAPK14 in the cytoplasm in an inactive form. The MAPKs bind to a dephosphorylated kinase interacting motif, phosphorylation of which by the protein kinase A complex re
• PDB: 2A8B
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00102	Y_phosphatase	415 → 646	Protein-tyrosine phosphatase	Domain

• Tissue specificity: TISSUE SPECIFICITY: Detected in cerebrospinal fluid (at protein level) (PubMed:25326458). Expressed in brain, placenta, small intestine, stomach, uterus and weakly in the prostate. Isoform alpha has been observed only in the brain. Isoform gamma is expres
• Sequence:

  MRRAVCFPALCLLLNLHAAGCFSGNNDHFLAINQKKSGKPVFIYKHSQDIEKSLDIAPQK
  IYRHSYHSSSEAQVSKRHQIVNSAFPRPAYDPSLNLLAMDGQDLEVENLPIPAANVIVVT
  LQMDVNKLNITLLRIFRQGVAAALGLLPQQVHINRLIGKKNSIELFVSPINRKTGISDAL
  PSEEVLRSLNINVLHQSLSQFGITEVSPEKNVLQGQHEADKIWSKEGFYAVVIFLSIFVI
  IVTCLMILYRLKERFQLSLRQDKEKNQEIHLSPITLQPALSEAKTVHSMVQPEQAPKVLN
  VVVDPQGRGAPEIKATTATSVCPSPFKMKPIGLQERRGSNVSLTLDMSSLGNIEPFVSIP
  TPREKVAMEYLQSASRILTRSQLRDVVASSHLLQSEFMEIPMNFVDPKEIDIPRHGTKNR
  YKTILPNPLSRVCLRPKNVTDSLSTYINANYIRGYSGKEKAFIATQGPMINTVDDFWQMV
  WQEDSPVIVMITKLKEKNEKCVLYWPEKRGIYGKVEVLVISVNECDNYTIRNLVLKQGSH
  TQHVKHYWYTSWPDHKTPDSAQPLLQLMLDVEEDRLASQGRGPVVVHCSAGIGRTGCFIA
  TSIGCQQLKEEGVVDALSIVCQLRMDRGGMVQTSEQYEFVHHALCLYESRLSAETVQ

• Sequence length: 657

Pathways

KEGG:

MAPK signaling pathway

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ATRIAL FIBRILLATION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CENTRAL NERVOUS SYSTEM CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOBLASTOMA MULTIFORME	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLIOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEONECROSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCOLIOSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UNIPOLAR DEPRESSION	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UTERINE FIBROID	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Carcinogenesis	Carcinogenesis	Pubtator	20015382	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	24242166		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	20015382	Inhibit	★☆☆☆☆ Found in Text Mining only
Hirschsprung Disease	Hirschsprung Disease	BEFREE	31024255		★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	29764005	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	29764005		★☆☆☆☆ Found in Text Mining only
Lip and Oral Cavity Carcinoma	Lip and Oral Cavity Carcinoma	BEFREE	27865370		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	38280930	Inhibit	★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	BEFREE	22100128, 28467119		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Major Depressive Disorder	Mental Depression	PSYGENET_DG	22100128		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant neoplasm of mouth	Malignant neoplasm of mouth	BEFREE	27865370		★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	34558606	Associate	★☆☆☆☆ Found in Text Mining only
Myopia	Myopia	Pubtator	23422819	Associate	★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	16441242	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	28611293	Associate	★☆☆☆☆ Found in Text Mining only
Plexiform leiomyoma	Plexiform leiomyoma	GWASCAT_DG	31649266		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	25592066	Associate	★☆☆☆☆ Found in Text Mining only
Severe myopia	Myopia	BEFREE	23422819		★☆☆☆☆ Found in Text Mining only
Unipolar Depression	Mental Depression	BEFREE	22100128, 28467119		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Unipolar Depression	Mental Depression	PSYGENET_DG	22100128		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine Fibroids	Uterine Fibroids	GWASCAT_DG	31649266		★☆☆☆☆ Found in Text Mining only