PTPRN2 (protein tyrosine phosphatase receptor type N2)

Gene

• Entrez ID: 5799
• Gene name: Protein tyrosine phosphatase receptor type N2
• Gene symbol: PTPRN2
• Synonyms (NCBI Gene): IA-2beta, IAR, ICAAR, PTPRP, R-PTP-N2
• Chromosome: 7
• Chromosome location: 7q36.3
• Summary: This gene encodes a protein with sequence similarity to receptor-like protein tyrosine phosphatases. However, tyrosine phosphatase activity has not been experimentally validated for this protein. Studies of the rat ortholog suggest that the encoded protei

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT002430	hsa-miR-335-5p	Review	19935707
MIRT002430	hsa-miR-335-5p	Luciferase reporter assay, Microarray	18185580
MIRT002430	hsa-miR-335-5p	Microarray;Other	18185580
MIRT712260	hsa-miR-342-3p	HITS-CLIP	19536157
MIRT712259	hsa-miR-1228-3p	HITS-CLIP	19536157
MIRT712258	hsa-miR-6515-3p	HITS-CLIP	19536157
MIRT712257	hsa-miR-1236-3p	HITS-CLIP	19536157
MIRT712256	hsa-miR-676-5p	HITS-CLIP	19536157
MIRT712255	hsa-miR-6715b-3p	HITS-CLIP	19536157
MIRT712254	hsa-miR-4753-3p	HITS-CLIP	19536157
MIRT712253	hsa-miR-4768-5p	HITS-CLIP	19536157
MIRT712252	hsa-miR-6833-3p	HITS-CLIP	19536157
MIRT712251	hsa-miR-6809-3p	HITS-CLIP	19536157
MIRT712260	hsa-miR-342-3p	HITS-CLIP	19536157
MIRT712259	hsa-miR-1228-3p	HITS-CLIP	19536157
MIRT712258	hsa-miR-6515-3p	HITS-CLIP	19536157
MIRT712257	hsa-miR-1236-3p	HITS-CLIP	19536157
MIRT712256	hsa-miR-676-5p	HITS-CLIP	19536157
MIRT712255	hsa-miR-6715b-3p	HITS-CLIP	19536157
MIRT712254	hsa-miR-4753-3p	HITS-CLIP	19536157
MIRT712253	hsa-miR-4768-5p	HITS-CLIP	19536157
MIRT712252	hsa-miR-6833-3p	HITS-CLIP	19536157
MIRT712251	hsa-miR-6809-3p	HITS-CLIP	19536157
MIRT712258	hsa-miR-6515-3p	HITS-CLIP	19536157
MIRT712257	hsa-miR-1236-3p	HITS-CLIP	19536157
MIRT712256	hsa-miR-676-5p	HITS-CLIP	19536157
MIRT712255	hsa-miR-6715b-3p	HITS-CLIP	19536157
MIRT712254	hsa-miR-4753-3p	HITS-CLIP	19536157
MIRT712253	hsa-miR-4768-5p	HITS-CLIP	19536157
MIRT712252	hsa-miR-6833-3p	HITS-CLIP	19536157
MIRT712251	hsa-miR-6809-3p	HITS-CLIP	19536157
MIRT712260	hsa-miR-342-3p	HITS-CLIP	19536157
MIRT712259	hsa-miR-1228-3p	HITS-CLIP	19536157
MIRT712258	hsa-miR-6515-3p	HITS-CLIP	19536157
MIRT712257	hsa-miR-1236-3p	HITS-CLIP	19536157
MIRT712256	hsa-miR-676-5p	HITS-CLIP	19536157
MIRT712255	hsa-miR-6715b-3p	HITS-CLIP	19536157
MIRT712254	hsa-miR-4753-3p	HITS-CLIP	19536157
MIRT712253	hsa-miR-4768-5p	HITS-CLIP	19536157
MIRT712252	hsa-miR-6833-3p	HITS-CLIP	19536157
MIRT712251	hsa-miR-6809-3p	HITS-CLIP	19536157
MIRT443096	hsa-miR-4311	PAR-CLIP	22100165
MIRT443094	hsa-miR-5680	PAR-CLIP	22100165
MIRT443093	hsa-miR-371b-5p	PAR-CLIP	22100165
MIRT443092	hsa-miR-373-5p	PAR-CLIP	22100165
MIRT443091	hsa-miR-616-5p	PAR-CLIP	22100165
MIRT443090	hsa-miR-371a-5p	PAR-CLIP	22100165
MIRT443089	hsa-miR-372-5p	PAR-CLIP	22100165
MIRT443088	hsa-miR-7110-3p	PAR-CLIP	22100165
MIRT443087	hsa-miR-539-5p	PAR-CLIP	22100165
MIRT712260	hsa-miR-342-3p	HITS-CLIP	19536157
MIRT712259	hsa-miR-1228-3p	HITS-CLIP	19536157
MIRT712258	hsa-miR-6515-3p	HITS-CLIP	19536157
MIRT712257	hsa-miR-1236-3p	HITS-CLIP	19536157
MIRT712256	hsa-miR-676-5p	HITS-CLIP	19536157
MIRT712255	hsa-miR-6715b-3p	HITS-CLIP	19536157
MIRT712254	hsa-miR-4753-3p	HITS-CLIP	19536157
MIRT712253	hsa-miR-4768-5p	HITS-CLIP	19536157
MIRT712252	hsa-miR-6833-3p	HITS-CLIP	19536157
MIRT712251	hsa-miR-6809-3p	HITS-CLIP	19536157
MIRT712260	hsa-miR-342-3p	HITS-CLIP	19536157
MIRT712259	hsa-miR-1228-3p	HITS-CLIP	19536157
MIRT712258	hsa-miR-6515-3p	HITS-CLIP	19536157
MIRT712257	hsa-miR-1236-3p	HITS-CLIP	19536157
MIRT712256	hsa-miR-676-5p	HITS-CLIP	19536157
MIRT712255	hsa-miR-6715b-3p	HITS-CLIP	19536157
MIRT712254	hsa-miR-4753-3p	HITS-CLIP	19536157
MIRT712253	hsa-miR-4768-5p	HITS-CLIP	19536157
MIRT712252	hsa-miR-6833-3p	HITS-CLIP	19536157
MIRT712251	hsa-miR-6809-3p	HITS-CLIP	19536157
MIRT712258	hsa-miR-6515-3p	HITS-CLIP	19536157
MIRT712257	hsa-miR-1236-3p	HITS-CLIP	19536157
MIRT712256	hsa-miR-676-5p	HITS-CLIP	19536157
MIRT712255	hsa-miR-6715b-3p	HITS-CLIP	19536157
MIRT712254	hsa-miR-4753-3p	HITS-CLIP	19536157
MIRT712253	hsa-miR-4768-5p	HITS-CLIP	19536157
MIRT712252	hsa-miR-6833-3p	HITS-CLIP	19536157
MIRT712251	hsa-miR-6809-3p	HITS-CLIP	19536157
MIRT712260	hsa-miR-342-3p	HITS-CLIP	19536157
MIRT712259	hsa-miR-1228-3p	HITS-CLIP	19536157
MIRT712258	hsa-miR-6515-3p	HITS-CLIP	19536157
MIRT712257	hsa-miR-1236-3p	HITS-CLIP	19536157
MIRT712256	hsa-miR-676-5p	HITS-CLIP	19536157
MIRT712255	hsa-miR-6715b-3p	HITS-CLIP	19536157
MIRT712254	hsa-miR-4753-3p	HITS-CLIP	19536157
MIRT712253	hsa-miR-4768-5p	HITS-CLIP	19536157
MIRT712252	hsa-miR-6833-3p	HITS-CLIP	19536157
MIRT712251	hsa-miR-6809-3p	HITS-CLIP	19536157
MIRT443096	hsa-miR-4311	PAR-CLIP	22100165
MIRT443094	hsa-miR-5680	PAR-CLIP	22100165
MIRT443093	hsa-miR-371b-5p	PAR-CLIP	22100165
MIRT443092	hsa-miR-373-5p	PAR-CLIP	22100165
MIRT443091	hsa-miR-616-5p	PAR-CLIP	22100165
MIRT443090	hsa-miR-371a-5p	PAR-CLIP	22100165
MIRT443089	hsa-miR-372-5p	PAR-CLIP	22100165
MIRT443088	hsa-miR-7110-3p	PAR-CLIP	22100165
MIRT443087	hsa-miR-539-5p	PAR-CLIP	22100165
MIRT1276339	hsa-miR-100	CLIP-seq
MIRT1276340	hsa-miR-582-3p	CLIP-seq
MIRT1276341	hsa-miR-99a	CLIP-seq
MIRT1276342	hsa-miR-99b	CLIP-seq
MIRT1276343	hsa-miR-3144-5p	CLIP-seq
MIRT1276344	hsa-miR-4426	CLIP-seq
MIRT1276345	hsa-miR-4532	CLIP-seq
MIRT1276346	hsa-miR-4534	CLIP-seq
MIRT1276347	hsa-miR-4647	CLIP-seq
MIRT1276348	hsa-miR-4648	CLIP-seq
MIRT1276349	hsa-miR-4654	CLIP-seq
MIRT1276350	hsa-miR-4662b	CLIP-seq
MIRT1276351	hsa-miR-4769-5p	CLIP-seq
MIRT1276352	hsa-miR-4802-5p	CLIP-seq
MIRT1276353	hsa-miR-765	CLIP-seq
MIRT2307252	hsa-miR-1202	CLIP-seq
MIRT2307253	hsa-miR-1237	CLIP-seq
MIRT2307254	hsa-miR-1248	CLIP-seq
MIRT2307255	hsa-miR-146b-3p	CLIP-seq
MIRT2307256	hsa-miR-150	CLIP-seq
MIRT2307257	hsa-miR-3157-3p	CLIP-seq
MIRT2307258	hsa-miR-3173-5p	CLIP-seq
MIRT2307259	hsa-miR-3194-5p	CLIP-seq
MIRT2307260	hsa-miR-3972	CLIP-seq
MIRT2307261	hsa-miR-4314	CLIP-seq
MIRT2307262	hsa-miR-4667-5p	CLIP-seq
MIRT2307263	hsa-miR-4695-3p	CLIP-seq
MIRT2307264	hsa-miR-4700-5p	CLIP-seq
MIRT2307265	hsa-miR-4707-5p	CLIP-seq
MIRT2307266	hsa-miR-4713-5p	CLIP-seq
MIRT2307267	hsa-miR-532-3p	CLIP-seq
MIRT2307268	hsa-miR-637	CLIP-seq
MIRT2307269	hsa-miR-874	CLIP-seq
MIRT2307270	hsa-miR-942	CLIP-seq
MIRT2307253	hsa-miR-1237	CLIP-seq
MIRT2307254	hsa-miR-1248	CLIP-seq
MIRT2307256	hsa-miR-150	CLIP-seq
MIRT2689107	hsa-miR-1915	CLIP-seq
MIRT2689108	hsa-miR-4459	CLIP-seq
MIRT2307266	hsa-miR-4713-5p	CLIP-seq
MIRT2689109	hsa-miR-4726-3p	CLIP-seq
MIRT2689110	hsa-miR-4779	CLIP-seq
MIRT2307267	hsa-miR-532-3p	CLIP-seq
MIRT2689111	hsa-miR-665	CLIP-seq
MIRT2307270	hsa-miR-942	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0004721	Function	Phosphoprotein phosphatase activity	IEA
GO:0004725	Function	Protein tyrosine phosphatase activity	IEA
GO:0005001	Function	Transmembrane receptor protein tyrosine phosphatase activity	TAS	8798755
GO:0005886	Component	Plasma membrane	TAS	8798755
GO:0006470	Process	Protein dephosphorylation	TAS	8798755
GO:0006629	Process	Lipid metabolic process	IEA
GO:0007269	Process	Neurotransmitter secretion	IEA
GO:0007269	Process	Neurotransmitter secretion	ISS
GO:0016020	Component	Membrane	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0030141	Component	Secretory granule	IBA
GO:0030141	Component	Secretory granule	IEA
GO:0030658	Component	Transport vesicle membrane	IEA
GO:0030667	Component	Secretory granule membrane	IEA
GO:0030667	Component	Secretory granule membrane	ISS
GO:0030672	Component	Synaptic vesicle membrane	IEA
GO:0030672	Component	Synaptic vesicle membrane	ISS
GO:0031410	Component	Cytoplasmic vesicle	IEA
GO:0035773	Process	Insulin secretion involved in cellular response to glucose stimulus	IBA
GO:0035773	Process	Insulin secretion involved in cellular response to glucose stimulus	IEA
GO:0035773	Process	Insulin secretion involved in cellular response to glucose stimulus	ISS
GO:0043235	Component	Receptor complex	IDA	23382219
GO:0045202	Component	Synapse	IBA
GO:0045202	Component	Synapse	IEA
GO:0051046	Process	Regulation of secretion	IBA
GO:0101003	Component	Ficolin-1-rich granule membrane	TAS

Other IDs

• MIM: 601698
• HGNC: 9677
• e!Ensembl: ENSG00000155093

Protein

• UniProt ID: Q92932
• Protein name: Receptor-type tyrosine-protein phosphatase N2 (R-PTP-N2) (EC 3.1.3.-) (EC 3.1.3.48) (Islet cell autoantigen-related protein) (IAR) (ICAAR) (Phogrin) [Cleaved into: IA-2beta60]
• Protein function: Plays a role in vesicle-mediated secretory processes. Required for normal accumulation of secretory vesicles in hippocampus, pituitary and pancreatic islets. Required for the accumulation of normal levels of insulin-containing vesicles and preve
• PDB: 2QEP, 4HTI, 4HTJ
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF14948	RESP18	59 → 144	RESP18 domain	Family
  PF11548	Receptor_IA-2	509 → 597	Protein-tyrosine phosphatase receptor IA-2	Family
  PF00102	Y_phosphatase	770 → 1004	Protein-tyrosine phosphatase	Domain

• Tissue specificity: TISSUE SPECIFICITY: Highest levels in brain and pancreas (PubMed:8798755, PubMed:8954911). Lower levels in trachea, prostate, stomach and spinal cord (PubMed:8798755). {ECO:0000269|PubMed:8798755, ECO:0000269|PubMed:8954911}.
• Sequence:

  MGPPLPLLLLLLLLLPPRVLPAAPSSVPRGRQLPGRLGCLLEEGLCGASEACVNDGVFGR
  CQKVPAMDFYRYEVSPVALQRLRVALQKLSGTGFTWQDDYTQYVMDQELADLPKTYLRRP
  EASSPARPSKHSVGSERRYSREGGAALANALRRHLPFLEALSQAPASDVLARTHTAQDRP
  PAEGDDRFSESILTYVAHTSALTYPPGSRTQLREDLLPRTLGQLQPDELSPKVDSGVDRH
  HLMAALSAYAAQRPPAPPGEGSLEPQYLLRAPSRMPRPLLAPAAPQKWPSPLGDSEDPSS
  TGDGARIHTLLKDLQRQPAEVRGLSGLELDGMAELMAGLMQGVDHGVARGSPGRAALGES
  GEQADGPKATLRGDSFPDDGVQDDDDRLYQEVHRLSATLGGLLQDHGSRLLPGALPFARP
  LDMERKKSEHPESSLSSEEETAGVENVKSQTYSKDLLGQQPHSEPGAAAFGELQNQMPGP
  SKEEQSLPAGAQEALSDGLQLEVQPSEEEARGYIVTDRDPLRPEEGRRLVEDVARLLQVP
  SSAFADVEVLGPAVTFKVSANVQNVTTEDVEKATVDNKDKLEETSGLKILQTGVGSKSKL
  KFLPPQAEQEDSTKFIALTLVSLACILGVLLASGLIYCLRHSSQHRLKEKLSGLGGDPGA
  DATAAYQELCRQRMATRPPDRPEGPHTSRISSVSSQFSDGPIPSPSARSSASSWSEEPVQ
  SNMDISTGHMILSYMEDHLKNKNRLEKEWEALCAYQAEPNSSFVAQREENVPKNRSLAVL
  TYDHSRVLLKAENSHSHSDYINASPIMDHDPRNPAYIATQGPLPATVADFWQMVWESGCV
  VIVMLTPLAENGVRQCYHYWPDEGSNLYHIYEVNLVSEHIWCEDFLVRSFYLKNLQTNET
  RTVTQFHFLSWYDRGVPSSSRSLLDFRRKVNKCYRGRSCPIIVHCSDGAGRSGTYVLIDM
  VLNKMAKGAKEIDIAATLEHLRDQRPGMVQTKEQFEFALTAVAEEVNAILKALPQ

• Sequence length: 1015

Pathways

KEGG:

Type I diabetes mellitus

Reactome:

Neutrophil degranulation

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ALZHEIMER DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AMYOTROPHIC LATERAL SCLEROSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATOPIC ECZEMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC RHINOSINUSITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CONNECTIVE TISSUE DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEFICIENCY ANEMIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DEMENTIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS, INSULIN-DEPENDENT	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETIC RETINOPATHY	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GASTROESOPHAGEAL REFLUX DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GLOMERULONEPHRITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPEROPIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY SKIN DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MALIGNANT EPITHELIAL TUMOR OF OVARY	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MENTAL OR BEHAVIOURAL DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MIXED CONNECTIVE TISSUE DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OSTEOARTHRITIS, KNEE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PELVIC ORGAN PROLAPSE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PERIPHERAL VASCULAR DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PREDIABETES SYNDROME	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PREECLAMPSIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostate cancer	Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSORIASIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RETINAL DETACHMENT	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCOLIOSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STOMACH DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SUBSTANCE ABUSE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
UPPER AERODIGESTIVE TRACT NEOPLASM	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Astrocytoma	Astrocytoma	Pubtator	27586084	Associate	★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	36457109	Associate	★☆☆☆☆ Found in Text Mining only
Attention deficit hyperactivity disorder	Attention Deficit Hyperactivity Disorder	BEFREE	21832240		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autistic Disorder	Autism	Pubtator	32291385	Associate	★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	19120304, 9389426		★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	25877877		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Carcinoma	Breast Carcinoma	GWASCAT_DG	29059430		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	40352186	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	28514750	Associate	★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	34895303	Associate	★☆☆☆☆ Found in Text Mining only
Chronic Kidney Diseases	Kidney Disease	GWASCAT_DG	29545352		★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	UNIPROT_DG			★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	34311674	Associate	★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	BEFREE	31424985		★☆☆☆☆ Found in Text Mining only
Depressive Disorder	Major depressive disorder	Pubtator	34341332	Associate	★☆☆☆☆ Found in Text Mining only
Dermatitis, Atopic	Dermatitis	GWASCAT_DG	25574825		★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	12672406, 15004204, 15220191, 18299317, 9714834		★☆☆☆☆ Found in Text Mining only
Diabetes Gestational	Gestational diabetes	Pubtator	35721735	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	12672406, 15004204, 15220191, 18299317, 9714834		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 1	Diabetes mellitus, type 1	Pubtator	30890718, 8798755	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	10330299, 10634407, 11937581, 14624760, 15220191, 16542366, 19120304, 19550073, 22950449, 30890718, 8826969, 9389426, 9725268, 9754810, 9862731		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	15765222		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	GWASCAT_DG	29221444		★☆☆☆☆ Found in Text Mining only
Duane Retraction Syndrome	Duane Retraction Syndrome	BEFREE	22950449		★☆☆☆☆ Found in Text Mining only
Endometrial Hyperplasia	Endometrial hyperplasia	Pubtator	21731750	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	27586084, 39505178	Associate	★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	36650953	Associate	★☆☆☆☆ Found in Text Mining only
Glomerulonephritis IGA	Iga nephropathy	Pubtator	22318827	Associate	★☆☆☆☆ Found in Text Mining only
Infertility Male	Male infertility	Pubtator	31103287, 37628668	Associate	★☆☆☆☆ Found in Text Mining only
Insulin Resistance	Diabetes mellitus, type 2	Pubtator	39180924	Associate	★☆☆☆☆ Found in Text Mining only
insulinoma	Insulinoma	BEFREE	10634407, 15220191, 19550073, 20091020, 8826969		★☆☆☆☆ Found in Text Mining only
Kidney Failure, Chronic	Kidney Failure	GWASCAT_DG	29545352		★☆☆☆☆ Found in Text Mining only
Leiomyosarcoma	Leiomyosarcoma	Pubtator	22419440, 33436720	Associate	★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	28514750		★☆☆☆☆ Found in Text Mining only
Lung Diseases	Lung disease	Pubtator	26425700	Associate	★☆☆☆☆ Found in Text Mining only
Malignant Childhood Neoplasm	Malignant Neoplasm	GWASCAT_DG	29059430		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	25877877		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	31221986		★☆☆☆☆ Found in Text Mining only
Marfan Syndrome	Marfan syndrome	Pubtator	34895303	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic Diseases	BEFREE	30890718		★☆☆☆☆ Found in Text Mining only
Metabolic Diseases	Metabolic syndrome	Pubtator	30890718	Associate	★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	29421825		★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	30958317	Associate	★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	GWASDB_DG	21211798		★☆☆☆☆ Found in Text Mining only
Myopia	Myopia	Pubtator	37884635	Associate	★☆☆☆☆ Found in Text Mining only
Myopia, Degenerative	Myopia	GWASCAT_DG	23049088		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	22950449		★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	Pubtator	28207535, 29976977, 30890718	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Parkinson Disease	Parkinson disease	Pubtator	30958317	Associate	★☆☆☆☆ Found in Text Mining only
Pediatric Obesity	Childhood obesity	BEFREE	30890718		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	31221986		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	31221986	Associate	★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	GWASCAT_DG	25574825		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	30765504	Associate	★☆☆☆☆ Found in Text Mining only
Respiratory Tract Diseases	Respiratory system infectious disease	Pubtator	35163587	Associate	★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	Pubtator	27474348	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	GWASCAT_DG	31374203		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	28236344	Associate	★☆☆☆☆ Found in Text Mining only
Stroke	Stroke	Pubtator	32172663	Associate	★☆☆☆☆ Found in Text Mining only
Vascular Diseases	Vascular disease	Pubtator	28693373	Associate	★☆☆☆☆ Found in Text Mining only