SLC46A2 (solute carrier family 46 member 2)

Gene

• Entrez ID: 57864
• Gene name: Solute carrier family 46 member 2
• Gene symbol: SLC46A2
• Synonyms (NCBI Gene): Ly110, TSCOT
• Chromosome: 9
• Chromosome location: 9q32

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT017709	hsa-miR-335-5p	Microarray	18185580
MIRT739134	hsa-miR-4324	HITS-CLIP	33718276
MIRT739135	hsa-miR-544b	HITS-CLIP	33718276
MIRT739139	hsa-miR-2861	CLIP-seq
MIRT1364618	hsa-miR-3163	CLIP-seq
MIRT1364619	hsa-miR-3182	CLIP-seq
MIRT1364620	hsa-miR-340	CLIP-seq
MIRT1364621	hsa-miR-3662	CLIP-seq
MIRT739138	hsa-miR-3670	CLIP-seq
MIRT1364622	hsa-miR-3671	CLIP-seq
MIRT1364623	hsa-miR-409-3p	CLIP-seq
MIRT1364624	hsa-miR-4314	CLIP-seq
MIRT1364625	hsa-miR-4488	CLIP-seq
MIRT739140	hsa-miR-4512	CLIP-seq
MIRT739137	hsa-miR-4667-3p	CLIP-seq
MIRT1364626	hsa-miR-4667-5p	CLIP-seq
MIRT1364627	hsa-miR-4697-5p	CLIP-seq
MIRT1364628	hsa-miR-4700-5p	CLIP-seq
MIRT1364629	hsa-miR-4777-3p	CLIP-seq
MIRT1364630	hsa-miR-511	CLIP-seq
MIRT1364631	hsa-miR-548c-3p	CLIP-seq
MIRT1364632	hsa-miR-637	CLIP-seq
MIRT739139	hsa-miR-2861	CLIP-seq
MIRT739138	hsa-miR-3670	CLIP-seq
MIRT739140	hsa-miR-4512	CLIP-seq
MIRT739137	hsa-miR-4667-3p	CLIP-seq
MIRT2108223	hsa-miR-150	CLIP-seq
MIRT739139	hsa-miR-2861	CLIP-seq
MIRT2108224	hsa-miR-3185	CLIP-seq
MIRT2108225	hsa-miR-3199	CLIP-seq
MIRT739138	hsa-miR-3670	CLIP-seq
MIRT739140	hsa-miR-4512	CLIP-seq
MIRT739137	hsa-miR-4667-3p	CLIP-seq
MIRT2108226	hsa-miR-4713-5p	CLIP-seq
MIRT2108227	hsa-miR-532-3p	CLIP-seq
MIRT2332018	hsa-miR-1228	CLIP-seq
MIRT2332019	hsa-miR-1236	CLIP-seq
MIRT2332020	hsa-miR-205	CLIP-seq
MIRT739139	hsa-miR-2861	CLIP-seq
MIRT2332021	hsa-miR-3155	CLIP-seq
MIRT2332022	hsa-miR-3155b	CLIP-seq
MIRT739138	hsa-miR-3670	CLIP-seq
MIRT2332023	hsa-miR-377	CLIP-seq
MIRT739140	hsa-miR-4512	CLIP-seq
MIRT739137	hsa-miR-4667-3p	CLIP-seq
MIRT2332024	hsa-miR-484	CLIP-seq
MIRT739139	hsa-miR-2861	CLIP-seq
MIRT739138	hsa-miR-3670	CLIP-seq
MIRT739140	hsa-miR-4512	CLIP-seq
MIRT739137	hsa-miR-4667-3p	CLIP-seq
MIRT1364623	hsa-miR-409-3p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002376	Process	Immune system process	IEA
GO:0005768	Component	Endosome	IEA
GO:0005886	Component	Plasma membrane	IDA	34235268
GO:0005886	Component	Plasma membrane	IEA
GO:0009986	Component	Cell surface	IEA
GO:0010008	Component	Endosome membrane	IEA
GO:0015293	Function	Symporter activity	NAS	10978518
GO:0016020	Component	Membrane	IBA
GO:0016020	Component	Membrane	IEA
GO:0016020	Component	Membrane	NAS	10978518
GO:0022857	Function	Transmembrane transporter activity	IBA
GO:0022857	Function	Transmembrane transporter activity	IEA
GO:0043029	Process	T cell homeostasis	IEA
GO:0045087	Process	Innate immune response	IEA
GO:0045580	Process	Regulation of T cell differentiation	IEA
GO:0048538	Process	Thymus development	IEA
GO:0055085	Process	Transmembrane transport	IBA
GO:0055085	Process	Transmembrane transport	IEA
GO:0070233	Process	Negative regulation of T cell apoptotic process	IEA
GO:0070430	Process	Positive regulation of nucleotide-binding oligomerization domain containing 1 signaling pathway	IMP	28539433
GO:0140360	Function	Cyclic-GMP-AMP transmembrane transporter activity	IDA	34235268
GO:0140361	Process	Cyclic-GMP-AMP transmembrane import across plasma membrane	IDA	34235268

Other IDs

• MIM: 608956
• HGNC: 16055
• e!Ensembl: ENSG00000119457

Protein

• UniProt ID: Q9BY10
• Protein name: Solute carrier family 46 member 2 (Thymic stromal cotransporter homolog)
• Protein function: Proton-coupled transporter that delivers pathogen-associated or danger-associated molecular patterns to cytosolic pattern recognition receptors as part of the innate immune response to microbes or tissue injury (PubMed:28539433, PubMed:34235268)
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF07690	MFS_1	68 → 422	Major Facilitator Superfamily	Family

• Tissue specificity: TISSUE SPECIFICITY: Strongly expressed in the adult thymus. Expressed in spleen, lymph nodes, thymus, PBL, bone marrow and fetal liver. Expressed in monocytes and pre-dendridic cells. {ECO:0000269|PubMed:10978518, ECO:0000269|PubMed:34235268}.
• Sequence:

  MSPEVTCPRRGHLPRFHPRTWVEPVVASSQVAASLYDAGLLLVVKASYGTGGSSNHSASP
  SPRGALEDQQQRAISNFYIIYNLVVGLSPLLSAYGLGWLSDRYHRKISICMSLLGFLLSR
  LGLLLKVLLDWPVEVLYGAAALNGLFGGFSAFWSGVMALGSLGSSEGRRSVRLILIDLML
  GLAGFCGSMASGHLFKQMAGHSGQGLILTACSVSCASFALLYSLLVLKVPESVAKPSQEL
  PAVDTVSGTVGTYRTLDPDQLDQQYAVGHPPSPGKAKPHKTTIALLFVGAIIYDLAVVGT
  VDVIPLFVLREPLGWNQVQVGYGMAAGYTIFITSFLGVLVFSRCFRDTTMIMIGMVSFGS
  GALLLAFVKETYMFYIARAVMLFALIPVTTIRSAMSKLIKGSSYGKVFVILQLSLALTGV
  VTSTLYNKIYQLTMDMFVGSCFALSSFLSFLAIIPISIVAYKQVPLSPYGDIIEK

• Sequence length: 475

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ALZHEIMER DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	37185598	Associate	★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	17035246, 18392855		★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	17035246, 18392855		★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	37185598	Associate	★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	17035246, 18392855		★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	Pubtator	39344312	Associate	★☆☆☆☆ Found in Text Mining only