PTPN13 (protein tyrosine phosphatase non-receptor type 13)

Gene

• Entrez ID: 5783
• Gene name: Protein tyrosine phosphatase non-receptor type 13
• Gene symbol: PTPN13
• Synonyms (NCBI Gene): FAP-1, PNP1, PTP-BAS, PTP-BL, PTP1E, PTPL1, PTPLE, hPTP1E
• Chromosome: 4
• Chromosome location: 4q21.3
• Summary: The protein encoded by this gene is a member of the protein tyrosine phosphatase (PTP) family. PTPs are signaling molecules that regulate a variety of cellular processes including cell growth, differentiation, mitotic cycle, and oncogenic transformation.

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT005593	hsa-miR-200c-3p	FACS, Luciferase reporter assay, qRT-PCR, Western blot	20620960
MIRT005593	hsa-miR-200c-3p	FACS, Luciferase reporter assay, qRT-PCR, Western blot	20620960
MIRT005894	hsa-miR-194-5p	Luciferase reporter assay, qRT-PCR, Western blot	20979124
MIRT005593	hsa-miR-200c-3p	Reporter assay	20620960
MIRT049422	hsa-miR-92a-3p	CLASH	23622248
MIRT045058	hsa-miR-186-5p	CLASH	23622248
MIRT043492	hsa-miR-331-3p	CLASH	23622248
MIRT213685	hsa-miR-26a-5p	Luciferase reporter assay, qRT-PCR, Western blot	27285768
MIRT213685	hsa-miR-26a-5p	Luciferase reporter assay, qRT-PCR, Western blot	27285768
MIRT1274839	hsa-miR-1297	CLIP-seq
MIRT1274840	hsa-miR-200b	CLIP-seq
MIRT1274841	hsa-miR-200c	CLIP-seq
MIRT1274842	hsa-miR-26a	CLIP-seq
MIRT1274843	hsa-miR-26b	CLIP-seq
MIRT1274844	hsa-miR-3120-3p	CLIP-seq
MIRT1274845	hsa-miR-320a	CLIP-seq
MIRT1274846	hsa-miR-320b	CLIP-seq
MIRT1274847	hsa-miR-320c	CLIP-seq
MIRT1274848	hsa-miR-320d	CLIP-seq
MIRT1274849	hsa-miR-429	CLIP-seq
MIRT1274850	hsa-miR-4310	CLIP-seq
MIRT1274851	hsa-miR-4429	CLIP-seq
MIRT1274852	hsa-miR-4465	CLIP-seq
MIRT1274853	hsa-miR-4693-5p	CLIP-seq
MIRT1274854	hsa-miR-4729	CLIP-seq
MIRT1274855	hsa-miR-498	CLIP-seq
MIRT1274856	hsa-miR-548c-3p	CLIP-seq
MIRT1274857	hsa-miR-616	CLIP-seq
MIRT1274840	hsa-miR-200b	CLIP-seq
MIRT1274841	hsa-miR-200c	CLIP-seq
MIRT1274845	hsa-miR-320a	CLIP-seq
MIRT1274846	hsa-miR-320b	CLIP-seq
MIRT1274847	hsa-miR-320c	CLIP-seq
MIRT1274848	hsa-miR-320d	CLIP-seq
MIRT1274849	hsa-miR-429	CLIP-seq
MIRT1274851	hsa-miR-4429	CLIP-seq
MIRT1274853	hsa-miR-4693-5p	CLIP-seq
MIRT1274854	hsa-miR-4729	CLIP-seq
MIRT1274857	hsa-miR-616	CLIP-seq
MIRT2080847	hsa-miR-30a	CLIP-seq
MIRT2080848	hsa-miR-30b	CLIP-seq
MIRT2080849	hsa-miR-30c	CLIP-seq
MIRT2080850	hsa-miR-30d	CLIP-seq
MIRT2080851	hsa-miR-30e	CLIP-seq
MIRT2306872	hsa-miR-101	CLIP-seq
MIRT1274839	hsa-miR-1297	CLIP-seq
MIRT2306873	hsa-miR-1322	CLIP-seq
MIRT2306874	hsa-miR-136	CLIP-seq
MIRT2306875	hsa-miR-144	CLIP-seq
MIRT1274840	hsa-miR-200b	CLIP-seq
MIRT1274841	hsa-miR-200c	CLIP-seq
MIRT1274842	hsa-miR-26a	CLIP-seq
MIRT1274843	hsa-miR-26b	CLIP-seq
MIRT2080847	hsa-miR-30a	CLIP-seq
MIRT2080848	hsa-miR-30b	CLIP-seq
MIRT2080849	hsa-miR-30c	CLIP-seq
MIRT2080850	hsa-miR-30d	CLIP-seq
MIRT2080851	hsa-miR-30e	CLIP-seq
MIRT2306876	hsa-miR-3163	CLIP-seq
MIRT1274845	hsa-miR-320a	CLIP-seq
MIRT1274846	hsa-miR-320b	CLIP-seq
MIRT1274847	hsa-miR-320c	CLIP-seq
MIRT1274848	hsa-miR-320d	CLIP-seq
MIRT2306877	hsa-miR-346	CLIP-seq
MIRT2306878	hsa-miR-4288	CLIP-seq
MIRT1274849	hsa-miR-429	CLIP-seq
MIRT1274851	hsa-miR-4429	CLIP-seq
MIRT1274852	hsa-miR-4465	CLIP-seq
MIRT1274853	hsa-miR-4693-5p	CLIP-seq
MIRT1274854	hsa-miR-4729	CLIP-seq
MIRT2306879	hsa-miR-4764-3p	CLIP-seq
MIRT2306880	hsa-miR-495	CLIP-seq
MIRT1274855	hsa-miR-498	CLIP-seq
MIRT1274857	hsa-miR-616	CLIP-seq
MIRT2306881	hsa-miR-632	CLIP-seq
MIRT2306882	hsa-miR-654-3p	CLIP-seq
MIRT2306883	hsa-miR-802	CLIP-seq
MIRT2306872	hsa-miR-101	CLIP-seq
MIRT2432327	hsa-miR-105	CLIP-seq
MIRT1274839	hsa-miR-1297	CLIP-seq
MIRT2306874	hsa-miR-136	CLIP-seq
MIRT2306875	hsa-miR-144	CLIP-seq
MIRT2432328	hsa-miR-194	CLIP-seq
MIRT1274840	hsa-miR-200b	CLIP-seq
MIRT1274841	hsa-miR-200c	CLIP-seq
MIRT1274842	hsa-miR-26a	CLIP-seq
MIRT1274843	hsa-miR-26b	CLIP-seq
MIRT2080847	hsa-miR-30a	CLIP-seq
MIRT2080848	hsa-miR-30b	CLIP-seq
MIRT2080849	hsa-miR-30c	CLIP-seq
MIRT2080850	hsa-miR-30d	CLIP-seq
MIRT2080851	hsa-miR-30e	CLIP-seq
MIRT2306876	hsa-miR-3163	CLIP-seq
MIRT1274845	hsa-miR-320a	CLIP-seq
MIRT1274846	hsa-miR-320b	CLIP-seq
MIRT1274847	hsa-miR-320c	CLIP-seq
MIRT1274848	hsa-miR-320d	CLIP-seq
MIRT2306877	hsa-miR-346	CLIP-seq
MIRT2432329	hsa-miR-410	CLIP-seq
MIRT2306878	hsa-miR-4288	CLIP-seq
MIRT1274849	hsa-miR-429	CLIP-seq
MIRT2432330	hsa-miR-433	CLIP-seq
MIRT1274851	hsa-miR-4429	CLIP-seq
MIRT1274852	hsa-miR-4465	CLIP-seq
MIRT1274854	hsa-miR-4729	CLIP-seq
MIRT2306879	hsa-miR-4764-3p	CLIP-seq
MIRT1274855	hsa-miR-498	CLIP-seq
MIRT2432331	hsa-miR-520d-5p	CLIP-seq
MIRT2432332	hsa-miR-524-5p	CLIP-seq
MIRT2432333	hsa-miR-548l	CLIP-seq
MIRT2432334	hsa-miR-548n	CLIP-seq
MIRT1274857	hsa-miR-616	CLIP-seq
MIRT2306881	hsa-miR-632	CLIP-seq
MIRT2306882	hsa-miR-654-3p	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
CEBPB	Unknown	11696979
NFKB1	Unknown	11696979;16306044
RELA	Unknown	11696979;16306044
STAT3	Activation	24191246
TP53	Unknown	11696979

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001933	Process	Negative regulation of protein phosphorylation	IMP	25893857
GO:0004721	Function	Phosphoprotein phosphatase activity	IEA
GO:0004725	Function	Protein tyrosine phosphatase activity	IBA
GO:0004725	Function	Protein tyrosine phosphatase activity	IDA	14516276, 15611135, 19307596
GO:0004725	Function	Protein tyrosine phosphatase activity	IEA
GO:0004725	Function	Protein tyrosine phosphatase activity	IMP	23604317
GO:0005515	Function	Protein binding	IPI	10826496, 10918185, 11356191, 12095257, 12724420, 14516276, 14698303, 17240990, 17657516, 18684861, 19307596, 23108400, 23604317, 23611113, 24316673
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IDA	10826496, 11356191
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	14516276
GO:0005737	Component	Cytoplasm	IEA
GO:0005856	Component	Cytoskeleton	IEA
GO:0005886	Component	Plasma membrane	IDA	14516276
GO:0005886	Component	Plasma membrane	TAS
GO:0006470	Process	Protein dephosphorylation	IDA	17657516
GO:0016787	Function	Hydrolase activity	IEA
GO:0030027	Component	Lamellipodium	IDA	11356191
GO:0030027	Component	Lamellipodium	IEA
GO:0035335	Process	Peptidyl-tyrosine dephosphorylation	IMP	23604317
GO:0036312	Function	Phosphatidylinositol 3-kinase regulatory subunit binding	IBA
GO:0036312	Function	Phosphatidylinositol 3-kinase regulatory subunit binding	IPI	23604317
GO:0042995	Component	Cell projection	IEA
GO:0044297	Component	Cell body	IEA
GO:0051896	Process	Regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IBA
GO:0051896	Process	Regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction	IDA	23604317
GO:0070062	Component	Extracellular exosome	HDA	19056867
GO:0097237	Process	Cellular response to toxic substance	IEA
GO:1904890	Process	Negative regulation of excitatory synapse assembly	IBA
GO:1904890	Process	Negative regulation of excitatory synapse assembly	IEA

Other IDs

• MIM: 600267
• HGNC: 9646
• e!Ensembl: ENSG00000163629

Protein

• UniProt ID: Q12923
• Protein name: Tyrosine-protein phosphatase non-receptor type 13 (EC 3.1.3.48) (Fas-associated protein-tyrosine phosphatase 1) (FAP-1) (PTP-BAS) (Protein-tyrosine phosphatase 1E) (PTP-E1) (hPTPE1) (Protein-tyrosine phosphatase PTPL1)
• Protein function: Tyrosine phosphatase which negatively regulates FAS-induced apoptosis and NGFR-mediated pro-apoptotic signaling (PubMed:15611135). May regulate phosphoinositide 3-kinase (PI3K) signaling through dephosphorylation of PIK3R2 (PubMed:23604317). {EC
• PDB: 1D5G, 1Q7X, 1WCH, 2M0Z, 2M10, 3LNX, 3LNY, 3PDZ, 5GLJ, 7QCX, 7QCY, 7XTY
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF09379	FERM_N	576 → 638	FERM N-terminal domain	Domain
  PF00373	FERM_M	666 → 781	FERM central domain	Domain
  PF09380	FERM_C	787 → 876	FERM C-terminal PH-like domain	Domain
  PF00595	PDZ	1093 → 1176	PDZ domain	Domain
  PF16599	PTN13_u3	1177 → 1367		Family
  PF00595	PDZ	1368 → 1450	PDZ domain	Domain
  PF00595	PDZ	1501 → 1585	PDZ domain	Domain
  PF00595	PDZ	1788 → 1866	PDZ domain	Domain
  PF00595	PDZ	1883 → 1961	PDZ domain	Domain
  PF00102	Y_phosphatase	2237 → 2466	Protein-tyrosine phosphatase	Domain

• Tissue specificity: TISSUE SPECIFICITY: Expressed in keratinocytes (at protein level) (PubMed:29043977). Present in most tissues with the exception of the liver and skeletal muscle. Most abundant in lung, kidney and fetal brain. {ECO:0000269|PubMed:29043977}.
• Sequence:

  MHVSLAEALEVRGGPLQEEEIWAVLNQSAESLQELFRKVSLADPAALGFIISPWSLLLLP
  SGSVSFTDENISNQDLRAFTAPEVLQNQSLTSLSDVEKIHIYSLGMTLYWGADYEVPQSQ
  PIKLGDHLNSILLGMCEDVIYARVSVRTVLDACSAHIRNSNCAPSFSYVKHLVKLVLGNL
  SGTDQLSCNSEQKPDRSQAIRDRLRGKGLPTGRSSTSDVLDIQKPPLSHQTFLNKGLSKS
  MGFLSIKDTQDENYFKDILSDNSGREDSENTFSPYQFKTSGPEKKPIPGIDVLSKKKIWA
  SSMDLLCTADRDFSSGETATYRRCHPEAVTVRTSTTPRKKEARYSDGSIALDIFGPQKMD
  PIYHTRELPTSSAISSALDRIRERQKKLQVLREAMNVEEPVRRYKTYHGDVFSTSSESPS
  IISSESDFRQVRRSEASKRFESSSGLPGVDETLSQGQSQRPSRQYETPFEGNLINQEIML
  KRQEEELMQLQAKMALRQSRLSLYPGDTIKASMLDITRDPLREIALETAMTQRKLRNFFG
  PEFVKMTIEPFISLDLPRSILTKKGKNEDNRRKVNIMLLNGQRLELTCDTKTICKDVFDM
  VVAHIGLVEHHLFALATLKDNEYFFVDPDLKLTKVAPEGWKEEPKKKTKATVNFTLFFRI
  KFFMDDVSLIQHTLTCHQYYLQLRKDILEERMHCDDETSLLLASLALQAEYGDYQPEVHG
  VSYFRMEHYLPARVMEKLDLSYIKEELPKLHNTYVGASEKETELEFLKVCQRLTEYGVHF
  HRVHPEKKSQTGILLGVCSKGVLVFEVHNGVRTLVLRFPWRETKKISFSKKKITLQNTSD
  GIKHGFQTDNSKICQYLLHLCSYQHKFQLQMRARQSNQDAQDIERASFRSLNLQAESVRG
  FNMGRAISTGSLASSTLNKLAVRPLSVQAEILKRLSCSELSLYQPLQNSSKEKNDKASWE
  EKPREMSKSYHDLSQASLYPHRKNVIVNMEPPPQTVAELVGKPSHQMSRSDAESLAGVTK
  LNNSKSVASLNRSPERRKHESDSSSIEDPGQAYVLGMTMHSSGNSSSQVPLKENDVLHKR
  WSIVSSPEREITLVNLKKDAKYGLGFQIIGGEKMGRLDLGIFISSVAPGGPADLDGCLKP
  GDRLISVNSVSLEGVSHHAAIEILQNAPEDVTLVISQPKEKISKVPSTPVHLTNEMKNYM
  KKSSYMQDSAIDSSSKDHHWSRGTLRHISENSFGPSGGLREGSLSSQDSRTESASLSQSQ
  VNGFFASHLGDQTWQESQHGSPSPSVISKATEKETFTDSNQSKTKKPGISDVTDYSDRGD
  SDMDEATYSSSQDHQTPKQESSSSVNTSNKMNFKTFSSSPPKPGDIFEVELAKNDNSLGI
  SVTGGVNTSVRHGGIYVKAVIPQGAAESDGRIHKGDRVLAVNGVSLEGATHKQAVETLRN
  TGQVVHLLLEKGQSPTSKEHVPVTPQCTLSDQNAQGQGPEKVKKTTQVKDYSFVTEENTF
  EVKLFKNSSGLGFSFSREDNLIPEQINASIVRVKKLFPGQPAAESGKIDVGDVILKVNGA
  SLKGLSQQEVISALRGTAPEVFLLLCRPPPGVLPEIDTALLTPLQSPAQVLPNSSKDSSQ
  PSCVEQSTSSDENEMSDKSKKQCKSPSRRDSYSDSSGSGEDDLVTAPANISNSTWSSALH
  QTLSNMVSQAQSHHEAPKSQEDTICTMFYYPQKIPNKPEFEDSNPSPLPPDMAPGQSYQP
  QSESASSSSMDKYHIHHISEPTRQENWTPLKNDLENHLEDFELEVELLITLIKSEKGSLG
  FTVTKGNQRIGCYVHDVIQDPAKSDGRLKPGDRLIKVNDTDVTNMTHTDAVNLLRAASKT
  VRLVIGRVLELPRIPMLPHLLPDITLTCNKEELGFSLCGGHDSLYQVVYISDINPRSVAA
  IEGNLQLLDVIHYVNGVSTQGMTLEEVNRALDMSLPSLVLKATRNDLPVVPSSKRSAVSA
  PKSTKGNGSYSVGSCSQPALTPNDSFSTVAGEEINEISYPKGKCSTYQIKGSPNLTLPKE
  SYIQEDDIYDDSQEAEVIQSLLDVVDEEAQNLLNENNAAGYSCGPGTLKMNGKLSEERTE
  DTDCDGSPLPEYFTEATKMNGCEEYCEEKVKSESLIQKPQEKKTDDDEITWGNDELPIER
  TNHEDSDKDHSFLTNDELAVLPVVKVLPSGKYTGANLKSVIRVLRGLLDQGIPSKELENL
  QELKPLDQCLIGQTKENRRKNRYKNILPYDATRVPLGDEGGYINASFIKIPVGKEEFVYI
  ACQGPLPTTVGDFWQMIWEQKSTVIAMMTQEVEGEKIKCQRYWPNILGKTTMVSNRLRLA
  LVRMQQLKGFVVRAMTLEDIQTREVRHISHLNFTAWPDHDTPSQPDDLLTFISYMRHIHR
  SGPIITHCSAGIGRSGTLICIDVVLGLISQDLDFDISDLVRCMRLQRHGMVQTEDQYIFC
  YQVILYVLTRLQAEEEQKQQPQLLK

• Sequence length: 2485

Pathways

KEGG:

Apoptosis

Reactome:

Synthesis of PIPs at the plasma membrane
Interleukin-37 signaling

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
Cervical cancer	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC KIDNEY DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Clear cell carcinoma of kidney	Conflicting classifications of pathogenicity	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colon adenocarcinoma	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETIC NEPHROPATHY	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FAMILIAL LONG QT SYNDROME	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Gastric cancer	Conflicting classifications of pathogenicity	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma	Likely benign; Conflicting classifications of pathogenicity	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant tumor of esophagus	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Melanoma	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Meniere disease	Uncertain significance	ClinVar Disgenet	★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
Nonpapillary renal cell carcinoma	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Ovarian serous cystadenocarcinoma	Conflicting classifications of pathogenicity	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PTPN13-related disorder	Conflicting classifications of pathogenicity; Uncertain significance; Likely benign; Benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Likely benign; Uncertain significance	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thymoma	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 1	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine carcinosarcoma	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Uterine corpus endometrial carcinoma	Likely benign	ClinVar	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adenocarcinoma of colon	Adenocarcinoma Of Colon	BEFREE	15494722		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma of lung (disorder)	Lung adenocarcinoma	BEFREE	28653805		★☆☆☆☆ Found in Text Mining only
Adult T-Cell Lymphoma/Leukemia	T-Cell Lymphoma/Leukemia	BEFREE	11472346		★☆☆☆☆ Found in Text Mining only
Astrocytoma	Astrocytoma	BEFREE	16187021		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	9491917		★☆☆☆☆ Found in Text Mining only
Bone Marrow Diseases	Bone Marrow Diseases	BEFREE	8857732, 9491917		★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain neoplasms	Pubtator	31888563	Associate	★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	19004008, 20501847, 22279592, 24338422, 29487338, 30464509		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	12354757, 19004008, 22279592, 24338422	Associate	★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	24338422	Inhibit	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	15494722		★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	26801674	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	22245727, 24191246, 30464509		★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	24191246, 26252379	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma, Ovarian Epithelial	Ovarian Epithelial carcinoma	BEFREE	29221157		★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	27339696		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Cervix carcinoma	Cervix carcinoma	BEFREE	27339696		★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	17585452, 20039457		★☆☆☆☆ Found in Text Mining only
Colonic Neoplasms	Colonic neoplasm	Pubtator	15494722, 20039457	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	15611135, 18038312, 18160445, 28504867		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	15494722, 15611135, 24338422, 33884652, 34045552	Associate	★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	BEFREE	15611135		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal Neoplasms	LHGDN	18038312		★☆☆☆☆ Found in Text Mining only
Communicating Hydrocephalus	Communicating Hydrocephalus	BEFREE	8857732		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes mellitus	Pubtator	38241313	Associate	★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	26133246		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophageal neoplasm	Pubtator	38039548	Associate	★☆☆☆☆ Found in Text Mining only
Esophageal Squamous Cell Carcinoma	Esophageal squamous cell carcinoma	Pubtator	38039548	Associate	★☆☆☆☆ Found in Text Mining only
Ewings sarcoma	Ewing sarcoma	BEFREE	15782144, 23018179		★☆☆☆☆ Found in Text Mining only
Familial Amyloid Neuropathy, Portuguese Type	Amyloid Neuropathy	BEFREE	16630162		★☆☆☆☆ Found in Text Mining only
Familial cylindromatosis	Familial cylindromatosis	Pubtator	29884612	Associate	★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	23950995		★☆☆☆☆ Found in Text Mining only
Head and Neck Carcinoma	Head And Neck Carcinoma	BEFREE	16888780		★☆☆☆☆ Found in Text Mining only
Hepatoblastoma	Hepatoblastoma	BEFREE	10398166		★☆☆☆☆ Found in Text Mining only
Hirschsprung Disease	Hirschsprung disease	Pubtator	29093530	Associate	★☆☆☆☆ Found in Text Mining only
Huntington Disease	Huntington Disease	BEFREE	16630162		★☆☆☆☆ Found in Text Mining only
Idiopathic Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	29727583		★☆☆☆☆ Found in Text Mining only
Laryngeal Neoplasms	Laryngeal neoplasm	Pubtator	19892796	Associate	★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	22262849		★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	39270538	Associate	★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	11274632, 16489062, 22434528, 26801674		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	24191246, 25837438, 26683690, 31826912	Associate	★☆☆☆☆ Found in Text Mining only
Lymphatic Metastasis	Lymphatic metastasis	Pubtator	31888563, 33884652	Stimulate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	26133246		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	BEFREE	26133246		★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin, Familial	Lymphoma	BEFREE	26133246		★☆☆☆☆ Found in Text Mining only
Machado-Joseph Disease	Machado-Joseph Disease	BEFREE	16630162		★☆☆☆☆ Found in Text Mining only
Malignant Head and Neck Neoplasm	Head and neck cancer	BEFREE	16888780		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	19004008, 20501847, 22279592, 24338422, 29487338, 30464509		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	22245727, 30464509		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of ovary	Ovarian cancer	BEFREE	29221157		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	11683408		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	22274591, 23559010		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	15494722, 18160445, 19672627, 21235435, 23559010, 23906871		★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	27339696		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	17585452		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	LHGDN	12354757, 19004008		★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	19004008, 20501847		★☆☆☆☆ Found in Text Mining only
MYELODYSPLASTIC SYNDROME	Myelodysplastic Syndrome	BEFREE	10497846		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	15782144, 17982484, 20501847, 21061268, 21235435, 22245727, 22274591, 22279592, 23108400, 23906871, 24191246, 26133246, 29221157, 30464509, 31358785		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	16630162		★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	22245727, 27285768, 29415055		★☆☆☆☆ Found in Text Mining only
Ovarian Carcinoma	Ovarian Carcinoma	BEFREE	29221157		★☆☆☆☆ Found in Text Mining only
ovarian neoplasm	Ovarian neoplasm	BEFREE	22688594		★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	11290551, 8824809	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	37895093	Inhibit	★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	11683408		★☆☆☆☆ Found in Text Mining only
Peripheral Nervous System Diseases	Nervous System Diseases	BEFREE	8857732		★☆☆☆☆ Found in Text Mining only
Peripheral Neuropathy	Peripheral Neuropathy	BEFREE	8857732		★☆☆☆☆ Found in Text Mining only
Peritoneal Neoplasms	Peritoneal neoplasm	Pubtator	26811494	Associate	★☆☆☆☆ Found in Text Mining only
Polycystic Kidney Autosomal Dominant	Polycystic kidney disease	Pubtator	8824809	Associate	★☆☆☆☆ Found in Text Mining only
Polyneuropathy	Polyneuropathy	BEFREE	8095018, 8857732		★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	22274591		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	22274591, 23559010	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Fibrosis	Pulmonary Fibrosis	BEFREE	29727583		★☆☆☆☆ Found in Text Mining only
Seminoma	Seminoma	BEFREE	16306258		★☆☆☆☆ Found in Text Mining only
Spinal Cord Diseases	Spinal Cord Diseases	BEFREE	8857732, 9491917		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	19734941		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	19892796	Associate	★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of lung	Lung carcinoma	BEFREE	23906871, 24191246		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma of the head and neck	Carcinoma Of The Head And Neck	BEFREE	19892796		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	26811494	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	27339696	Associate	★☆☆☆☆ Found in Text Mining only