Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	57827
Gene name	Chromosome 6 open reading frame 47
Gene symbol	C6orf47
Synonyms (NCBI Gene)	D6S53EG4NG34
Chromosome	6
Chromosome location	6p21.33

Show/Hide all (78)

miRTarBase ID	miRNA	Experiments	Reference
MIRT050157	hsa-miR-26a-5p	CLASH	23622248
MIRT528183	hsa-miR-200b-3p	PAR-CLIP	22012620
MIRT528182	hsa-miR-200c-3p	PAR-CLIP	22012620
MIRT528181	hsa-miR-429	PAR-CLIP	22012620
MIRT528180	hsa-miR-193a-3p	PAR-CLIP	22012620
MIRT528179	hsa-miR-193b-3p	PAR-CLIP	22012620
MIRT528178	hsa-miR-323b-3p	PAR-CLIP	22012620
MIRT528177	hsa-miR-4667-3p	PAR-CLIP	22012620
MIRT528176	hsa-miR-660-3p	PAR-CLIP	22012620
MIRT528175	hsa-miR-4722-3p	PAR-CLIP	22012620
MIRT528174	hsa-miR-6727-3p	PAR-CLIP	22012620
MIRT528173	hsa-miR-6747-3p	PAR-CLIP	22012620
MIRT528172	hsa-miR-1976	PAR-CLIP	22012620
MIRT528171	hsa-miR-4290	PAR-CLIP	22012620
MIRT528170	hsa-miR-1291	PAR-CLIP	22012620
MIRT528169	hsa-miR-6775-3p	PAR-CLIP	22012620
MIRT528168	hsa-miR-6851-3p	PAR-CLIP	22012620
MIRT528167	hsa-miR-192-3p	PAR-CLIP	22012620
MIRT528166	hsa-miR-328-3p	PAR-CLIP	22012620
MIRT528183	hsa-miR-200b-3p	PAR-CLIP	22012620
MIRT528182	hsa-miR-200c-3p	PAR-CLIP	22012620
MIRT528181	hsa-miR-429	PAR-CLIP	22012620
MIRT528180	hsa-miR-193a-3p	PAR-CLIP	22012620
MIRT528179	hsa-miR-193b-3p	PAR-CLIP	22012620
MIRT528178	hsa-miR-323b-3p	PAR-CLIP	22012620
MIRT528177	hsa-miR-4667-3p	PAR-CLIP	22012620
MIRT528176	hsa-miR-660-3p	PAR-CLIP	22012620
MIRT528175	hsa-miR-4722-3p	PAR-CLIP	22012620
MIRT528174	hsa-miR-6727-3p	PAR-CLIP	22012620
MIRT528173	hsa-miR-6747-3p	PAR-CLIP	22012620
MIRT528172	hsa-miR-1976	PAR-CLIP	22012620
MIRT528171	hsa-miR-4290	PAR-CLIP	22012620
MIRT528170	hsa-miR-1291	PAR-CLIP	22012620
MIRT528169	hsa-miR-6775-3p	PAR-CLIP	22012620
MIRT528168	hsa-miR-6851-3p	PAR-CLIP	22012620
MIRT528167	hsa-miR-192-3p	PAR-CLIP	22012620
MIRT528166	hsa-miR-328-3p	PAR-CLIP	22012620
MIRT851608	hsa-miR-125a-5p	CLIP-seq
MIRT851609	hsa-miR-125b	CLIP-seq
MIRT851610	hsa-miR-137	CLIP-seq
MIRT851611	hsa-miR-2355-5p	CLIP-seq
MIRT851612	hsa-miR-3144-5p	CLIP-seq
MIRT851613	hsa-miR-3191	CLIP-seq
MIRT851614	hsa-miR-3943	CLIP-seq
MIRT851615	hsa-miR-4319	CLIP-seq
MIRT851616	hsa-miR-4323	CLIP-seq
MIRT851617	hsa-miR-4652-5p	CLIP-seq
MIRT851618	hsa-miR-4659a-3p	CLIP-seq
MIRT851619	hsa-miR-4659b-3p	CLIP-seq
MIRT851620	hsa-miR-4663	CLIP-seq
MIRT851621	hsa-miR-4732-3p	CLIP-seq
MIRT851622	hsa-miR-4765	CLIP-seq
MIRT851623	hsa-miR-491-5p	CLIP-seq
MIRT851624	hsa-miR-544b	CLIP-seq
MIRT851625	hsa-miR-628-5p	CLIP-seq
MIRT851626	hsa-miR-670	CLIP-seq
MIRT1952519	hsa-miR-146b-3p	CLIP-seq
MIRT1952520	hsa-miR-3663-5p	CLIP-seq
MIRT1952521	hsa-miR-874	CLIP-seq
MIRT2190374	hsa-miR-193b	CLIP-seq
MIRT2190375	hsa-miR-200b	CLIP-seq
MIRT2190376	hsa-miR-200c	CLIP-seq
MIRT2190377	hsa-miR-3130-3p	CLIP-seq
MIRT851612	hsa-miR-3144-5p	CLIP-seq
MIRT851613	hsa-miR-3191	CLIP-seq
MIRT2190378	hsa-miR-328	CLIP-seq
MIRT2190379	hsa-miR-4438	CLIP-seq
MIRT851617	hsa-miR-4652-5p	CLIP-seq
MIRT2190380	hsa-miR-4793-3p	CLIP-seq
MIRT851623	hsa-miR-491-5p	CLIP-seq
MIRT2190381	hsa-miR-5095	CLIP-seq
MIRT2494410	hsa-miR-3151	CLIP-seq
MIRT2494411	hsa-miR-3622a-3p	CLIP-seq
MIRT2494412	hsa-miR-3622b-3p	CLIP-seq
MIRT2494413	hsa-miR-4447	CLIP-seq
MIRT2494414	hsa-miR-4472	CLIP-seq
MIRT2494415	hsa-miR-4640-3p	CLIP-seq
MIRT851623	hsa-miR-491-5p	CLIP-seq

Show/Hide all (1)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	32296183

MIM	HGNC	e!Ensembl
HGNC	N/A	HGNC

O95873

Protein name

Uncharacterized protein C6orf47 (Protein G4)

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF15576	DUF4661	16 → 265	Domain of unknown function (DUF4661)	Family

Sequence

MFLRRLGGWLPRPWGRRKPMRPDPPYPEPRRVDSSSENSGSDWDSAPETMEDVGHPKTKD
SGALRVSGAASEPSKEEPQVEQLGSKRMDSLKWDQPISSTQESGRLEAGGASPKLRWDHV
DSGGTRRPGVSPEGGLSVPGPGAPLEKPGRREKLLGWLRGEPGAPSRYLGGPEECLQIST
NLTLHLLELLASALLALCSRPLRAALDTLGLRGPLGLWLHGLLSFLAALHGLHAVLSLLT
AHPLHFACLFGLLQALVLAVSLREPNGDEAATDWESEGLEREGEEQRGDPGKGL

Sequence length

294

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (7)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
CROHN'S DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FAMILIAL APOLIPOPROTEIN B HYPOBETALIPOPROTEINEMIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INFLAMMATORY BOWEL DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATOID ARTHRITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ULCERATIVE COLITIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (12)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Celiac Disease	Celiac disease	BEFREE	28282431		★★★★★ ★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	Pubtator	28282431	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	GWASDB_DG	17632545		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	29511029		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	29511029		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hashimoto Disease	Hashimoto Disease	BEFREE	29541194		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin	Non-Hodgkin lymphoma	BEFREE	28282431		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphoma, Non-Hodgkin, Familial	Lymphoma	BEFREE	28282431		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	29511029		★★★★★ ★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	29541194		★★★★★ ★☆☆☆☆ Found in Text Mining only
Premature Menopause	Premature Menopause	BEFREE	28282431		★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	GWASDB_DG	17804836, 19503088, 21156761		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

C6orf47 (chromosome 6 open reading frame 47)