Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	57823
Gene name	SLAM family member 7
Gene symbol	SLAMF7
Synonyms (NCBI Gene)	19ACD319CRACCCS1
Chromosome	1
Chromosome location	1q23.3

108

Show/Hide all (108)

miRTarBase ID	miRNA	Experiments
MIRT1351495	hsa-miR-1	CLIP-seq
MIRT1351496	hsa-miR-1273f	CLIP-seq
MIRT1351497	hsa-miR-206	CLIP-seq
MIRT1351498	hsa-miR-3128	CLIP-seq
MIRT1351499	hsa-miR-3149	CLIP-seq
MIRT1351500	hsa-miR-3170	CLIP-seq
MIRT1351501	hsa-miR-3200-3p	CLIP-seq
MIRT1351502	hsa-miR-33a	CLIP-seq
MIRT1351503	hsa-miR-33b	CLIP-seq
MIRT1351504	hsa-miR-3673	CLIP-seq
MIRT1351505	hsa-miR-3682-5p	CLIP-seq
MIRT1351506	hsa-miR-411	CLIP-seq
MIRT1351507	hsa-miR-4263	CLIP-seq
MIRT1351508	hsa-miR-4292	CLIP-seq
MIRT1351509	hsa-miR-450b-3p	CLIP-seq
MIRT1351510	hsa-miR-4720-5p	CLIP-seq
MIRT1351511	hsa-miR-4738-3p	CLIP-seq
MIRT1351512	hsa-miR-4799-3p	CLIP-seq
MIRT1351513	hsa-miR-508-5p	CLIP-seq
MIRT1351514	hsa-miR-5095	CLIP-seq
MIRT1351515	hsa-miR-545	CLIP-seq
MIRT1351516	hsa-miR-552	CLIP-seq
MIRT1351517	hsa-miR-574-3p	CLIP-seq
MIRT1351518	hsa-miR-613	CLIP-seq
MIRT1351519	hsa-miR-764	CLIP-seq
MIRT1351520	hsa-miR-769-3p	CLIP-seq
MIRT2104181	hsa-miR-1245b-3p	CLIP-seq
MIRT2104182	hsa-miR-1915	CLIP-seq
MIRT2104183	hsa-miR-3187-3p	CLIP-seq
MIRT2104184	hsa-miR-3545-3p	CLIP-seq
MIRT2104185	hsa-miR-3663-5p	CLIP-seq
MIRT2104186	hsa-miR-4330	CLIP-seq
MIRT2104187	hsa-miR-4435	CLIP-seq
MIRT2104188	hsa-miR-4635	CLIP-seq
MIRT2104189	hsa-miR-4680-5p	CLIP-seq
MIRT2104190	hsa-miR-4701-5p	CLIP-seq
MIRT2104191	hsa-miR-4716-5p	CLIP-seq
MIRT2104192	hsa-miR-4726-3p	CLIP-seq
MIRT2104193	hsa-miR-4755-3p	CLIP-seq
MIRT2104194	hsa-miR-4757-5p	CLIP-seq
MIRT2104195	hsa-miR-4772-3p	CLIP-seq
MIRT2104196	hsa-miR-4781-3p	CLIP-seq
MIRT2104197	hsa-miR-498	CLIP-seq
MIRT2104198	hsa-miR-5096	CLIP-seq
MIRT2104199	hsa-miR-532-5p	CLIP-seq
MIRT1351515	hsa-miR-545	CLIP-seq
MIRT2104200	hsa-miR-548s	CLIP-seq
MIRT1351517	hsa-miR-574-3p	CLIP-seq
MIRT2104201	hsa-miR-588	CLIP-seq
MIRT2328308	hsa-miR-106a	CLIP-seq
MIRT2328309	hsa-miR-106b	CLIP-seq
MIRT2328310	hsa-miR-1295	CLIP-seq
MIRT2328311	hsa-miR-149	CLIP-seq
MIRT2328312	hsa-miR-150	CLIP-seq
MIRT2328313	hsa-miR-17	CLIP-seq
MIRT2104182	hsa-miR-1915	CLIP-seq
MIRT2328314	hsa-miR-20a	CLIP-seq
MIRT2328315	hsa-miR-20b	CLIP-seq
MIRT2328316	hsa-miR-24	CLIP-seq
MIRT2328317	hsa-miR-302a	CLIP-seq
MIRT2328318	hsa-miR-302b	CLIP-seq
MIRT2328319	hsa-miR-302c	CLIP-seq
MIRT2328320	hsa-miR-302d	CLIP-seq
MIRT2328321	hsa-miR-302e	CLIP-seq
MIRT2328322	hsa-miR-3064-5p	CLIP-seq
MIRT2328323	hsa-miR-3135	CLIP-seq
MIRT2104183	hsa-miR-3187-3p	CLIP-seq
MIRT2328324	hsa-miR-372	CLIP-seq
MIRT2328325	hsa-miR-373	CLIP-seq
MIRT2328326	hsa-miR-3934	CLIP-seq
MIRT2328327	hsa-miR-4284	CLIP-seq
MIRT2328328	hsa-miR-4423-5p	CLIP-seq
MIRT2104187	hsa-miR-4435	CLIP-seq
MIRT2104190	hsa-miR-4701-5p	CLIP-seq
MIRT2104191	hsa-miR-4716-5p	CLIP-seq
MIRT2104192	hsa-miR-4726-3p	CLIP-seq
MIRT2328329	hsa-miR-4731-5p	CLIP-seq
MIRT2328330	hsa-miR-4743	CLIP-seq
MIRT2104193	hsa-miR-4755-3p	CLIP-seq
MIRT2104194	hsa-miR-4757-5p	CLIP-seq
MIRT2104195	hsa-miR-4772-3p	CLIP-seq
MIRT2328331	hsa-miR-4774-3p	CLIP-seq
MIRT2104196	hsa-miR-4781-3p	CLIP-seq
MIRT2328332	hsa-miR-4794	CLIP-seq
MIRT2104197	hsa-miR-498	CLIP-seq
MIRT1351514	hsa-miR-5095	CLIP-seq
MIRT2328333	hsa-miR-512-3p	CLIP-seq
MIRT2328334	hsa-miR-519d	CLIP-seq
MIRT2328335	hsa-miR-520a-3p	CLIP-seq
MIRT2328336	hsa-miR-520b	CLIP-seq
MIRT2328337	hsa-miR-520c-3p	CLIP-seq
MIRT2328338	hsa-miR-520d-3p	CLIP-seq
MIRT2328339	hsa-miR-520e	CLIP-seq
MIRT2328340	hsa-miR-520g	CLIP-seq
MIRT2328341	hsa-miR-520h	CLIP-seq
MIRT2104199	hsa-miR-532-5p	CLIP-seq
MIRT2104200	hsa-miR-548s	CLIP-seq
MIRT1351516	hsa-miR-552	CLIP-seq
MIRT1351517	hsa-miR-574-3p	CLIP-seq
MIRT2104201	hsa-miR-588	CLIP-seq
MIRT1351519	hsa-miR-764	CLIP-seq
MIRT2328342	hsa-miR-93	CLIP-seq
MIRT2394596	hsa-miR-219-2-3p	CLIP-seq
MIRT2104182	hsa-miR-1915	CLIP-seq
MIRT2104192	hsa-miR-4726-3p	CLIP-seq
MIRT2104197	hsa-miR-498	CLIP-seq
MIRT2623082	hsa-miR-500a	CLIP-seq
MIRT2104199	hsa-miR-532-5p	CLIP-seq

Show/Hide all (12)

GO ID	Ontology	Definition	Evidence	Reference
GO:0002250	Process	Adaptive immune response	IEA
GO:0002376	Process	Immune system process	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0006955	Process	Immune response	IBA
GO:0007155	Process	Cell adhesion	NAS	11802771
GO:0009897	Component	External side of plasma membrane	IBA
GO:0016020	Component	Membrane	IEA
GO:0030101	Process	Natural killer cell activation	NAS	11698418
GO:0042110	Process	T cell activation	IBA
GO:0042267	Process	Natural killer cell mediated cytotoxicity	NAS	11698418
GO:0042802	Function	Identical protein binding	IPI	15153464, 21982860
GO:0045087	Process	Innate immune response	IEA

MIM	HGNC	e!Ensembl
606625	21394	ENSG00000026751

Q9NQ25

Protein name

SLAM family member 7 (CD2 subset 1) (CD2-like receptor-activating cytotoxic cells) (CRACC) (Membrane protein FOAP-12) (Novel Ly9) (Protein 19A) (CD antigen CD319)

Protein function

Self-ligand receptor of the signaling lymphocytic activation molecule (SLAM) family. SLAM receptors triggered by homo- or heterotypic cell-cell interactions are modulating the activation and differentiation of a wide variety of immune cells and

Family and domains

Tissue specificity

TISSUE SPECIFICITY: Expressed in spleen, lymph node, peripheral blood leukocytes, bone marrow, small intestine, stomach, appendix, lung and trachea. Expression was detected in NK cells, activated B-cells, NK-cell line but not in promyelocytic, B-, or T-ce

Sequence

MAGSPTCLTLIYILWQLTGSAASGPVKELVGSVGGAVTFPLKSKVKQVDSIVWTFNTTPL
VTIQPEGGTIIVTQNRNRERVDFPDGGYSLKLSKLKKNDSGIYYVGIYSSSLQQPSTQEY
VLHVYEHLSKPKVTMGLQSNKNGTCVTNLTCCMEHGEEDVIYTWKALGQAANESHNGSIL
PISWRWGESDMTFICVARNPVSRNFSSPILARKLCEGAADDPDSSMVLLCLLLVPLLLSL
FVLGLFLWFLKRERQEEYIEEKKRVDICRETPNICPHSGENTEYDTIPHTNRTILKEDPA
NTVYSTVEIPKKMENPHSLLTMPDTPRLFAYENVI

Sequence length

335

Interactions

View interactions

	Reactome
			Immunoregulatory interactions between a Lymphoid and a non-Lymphoid cell

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (8)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
AUTISTIC DISORDER	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CERVICAL CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CERVICAL CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG ADENOCARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE SCLEROSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SQUAMOUS CELL CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (38)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adult Diffuse Large B-Cell Lymphoma	B-cell Lymphoma	BEFREE	30710089		★★★★★ ★☆☆☆☆ Found in Text Mining only
Aggressive Periodontitis	Aggressive Periodontitis	BEFREE	23250953		★★★★★ ★☆☆☆☆ Found in Text Mining only
Angina Pectoris	Angina pectoris	Pubtator	26823790	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	29905534		★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	35148199	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Asthma	Asthma	Pubtator	34510493	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	29905534		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	Pubtator	29905534	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	23139634	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	24130905, 28211524	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carotid Artery Diseases	Carotid artery disease	Pubtator	29905534	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colitis Ulcerative	Ulcerative colitis	Pubtator	33201212, 38303405	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	30918427	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital thrombotic disease due to Protein C deficiency	Congenital thrombotic thrombocytopenic purpura	Pubtator	26666746, 27109862	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Crohn Disease	Crohn disease	Pubtator	33201212, 35148199	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	BEFREE	30710089		★★★★★ ★☆☆☆☆ Found in Text Mining only
Germ cell tumor	Tumor	BEFREE	29514158		★★★★★ ★☆☆☆☆ Found in Text Mining only
Inflammatory Bowel Diseases	Inflammatory bowel disease	Pubtator	33201212	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	20345977, 23956418, 33828555	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	28076903, 29020082	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus, Systemic	Lupus Erythematosus	BEFREE	18216865, 28076903, 29020082, 30347240		★★★★★ ★☆☆☆☆ Found in Text Mining only
Lymphopenia	Lymphopenia	BEFREE	29572070		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	29089645, 30347240, 30710089		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	LHGDN	17906076, 18451245		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	BEFREE	19723891, 23900284, 24385542, 26666746, 27376202, 27848182, 28070715, 28210004, 28259300, 28356715, 28744161, 28779463, 28861320, 28932638, 29089311 View all (16 more)		★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	Pubtator	23900284, 24385542, 26666746, 29089645, 30519736, 31431433, 33575947, 33846552, 35276027, 36245253, 38035078	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	GWASCAT_DG	24076602		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis	Multiple sclerosis	Pubtator	36864689, 37903821	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myocardial Infarction	Myocardial infarction	Pubtator	26823790	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	35525858	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	27322696		★★★★★ ★☆☆☆☆ Found in Text Mining only
Nongerminomatous Germ Cell Tumor	Nongerminomatous Tumor	BEFREE	29514158		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	32149080, 36978087	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Periodontal Diseases	Periodontal Diseases	BEFREE	23250953		★★★★★ ★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	BEFREE	23250953		★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	Pubtator	38303405	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin Neoplasms	Skin neoplasm	Pubtator	28211524	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Testicular Germ Cell Tumor	Testicular Germ Cell Tumor	BEFREE	28320414, 29514158		★★★★★ ★☆☆☆☆ Found in Text Mining only

SLAMF7 (SLAM family member 7)