BAK1 (BCL2 antagonist/killer 1)

Gene

• Entrez ID: 578
• Gene name: BCL2 antagonist/killer 1
• Gene symbol: BAK1
• Synonyms (NCBI Gene): BAK, BAK-LIKE, BCL2L7, CDN1
• Chromosome: 6
• Chromosome location: 6p21.31
• Summary: The protein encoded by this gene belongs to the BCL2 protein family. BCL2 family members form oligomers or heterodimers and act as anti- or pro-apoptotic regulators that are involved in a wide variety of cellular activities. This protein localizes to mito

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT005350	hsa-miR-125a-5p	Flow, Luciferase reporter assay, qRT-PCR, Western blot	20616003
MIRT002394	hsa-miR-125b-5p	Luciferase reporter assay, qRT-PCR, Western blot	18056640
MIRT002394	hsa-miR-125b-5p	Luciferase reporter assay, qRT-PCR, Western blot	21823019
MIRT002394	hsa-miR-125b-5p	Luciferase reporter assay, qRT-PCR, Western blot	21823019
MIRT002394	hsa-miR-125b-5p	Luciferase reporter assay, qRT-PCR, Western blot	21823019
MIRT002394	hsa-miR-125b-5p	Luciferase reporter assay	23497288
MIRT019714	hsa-miR-375	Microarray	20215506
MIRT002394	hsa-miR-125b-5p	Other	20729973
MIRT048976	hsa-miR-92a-3p	CLASH	23622248
MIRT002394	hsa-miR-125b-5p	Luciferase reporter assay	23928699
MIRT002394	hsa-miR-125b-5p	Luciferase reporter assay	23928699
MIRT002394	hsa-miR-125b-5p	Luciferase reporter assay	23928699
MIRT002394	hsa-miR-125b-5p	Luciferase reporter assay	23928699
MIRT568311	hsa-miR-92b-3p	PAR-CLIP	20371350
MIRT048976	hsa-miR-92a-3p	PAR-CLIP	20371350
MIRT568310	hsa-miR-367-3p	PAR-CLIP	20371350
MIRT568309	hsa-miR-363-3p	PAR-CLIP	20371350
MIRT568308	hsa-miR-25-3p	PAR-CLIP	20371350
MIRT568307	hsa-miR-32-5p	PAR-CLIP	20371350
MIRT568306	hsa-miR-3184-5p	PAR-CLIP	20371350
MIRT568305	hsa-miR-423-5p	PAR-CLIP	20371350
MIRT568304	hsa-miR-1914-3p	PAR-CLIP	20371350
MIRT568302	hsa-miR-5194	PAR-CLIP	20371350
MIRT568303	hsa-miR-6738-5p	PAR-CLIP	20371350
MIRT568301	hsa-miR-4450	PAR-CLIP	20371350
MIRT568300	hsa-miR-4710	PAR-CLIP	20371350
MIRT568299	hsa-miR-6734-5p	PAR-CLIP	20371350
MIRT568298	hsa-miR-3145-5p	PAR-CLIP	20371350
MIRT568311	hsa-miR-92b-3p	PAR-CLIP	20371350
MIRT048976	hsa-miR-92a-3p	PAR-CLIP	20371350
MIRT568310	hsa-miR-367-3p	PAR-CLIP	20371350
MIRT568309	hsa-miR-363-3p	PAR-CLIP	20371350
MIRT568308	hsa-miR-25-3p	PAR-CLIP	20371350
MIRT568307	hsa-miR-32-5p	PAR-CLIP	20371350
MIRT568306	hsa-miR-3184-5p	PAR-CLIP	20371350
MIRT568305	hsa-miR-423-5p	PAR-CLIP	20371350
MIRT568304	hsa-miR-1914-3p	PAR-CLIP	20371350
MIRT568302	hsa-miR-5194	PAR-CLIP	20371350
MIRT568303	hsa-miR-6738-5p	PAR-CLIP	20371350
MIRT568301	hsa-miR-4450	PAR-CLIP	20371350
MIRT568300	hsa-miR-4710	PAR-CLIP	20371350
MIRT568299	hsa-miR-6734-5p	PAR-CLIP	20371350
MIRT568298	hsa-miR-3145-5p	PAR-CLIP	20371350
MIRT526692	hsa-miR-1272	PAR-CLIP	22012620
MIRT526691	hsa-miR-1245b-3p	PAR-CLIP	22012620
MIRT526690	hsa-miR-4310	PAR-CLIP	22012620
MIRT526689	hsa-miR-7157-5p	PAR-CLIP	22012620
MIRT526688	hsa-miR-221-5p	PAR-CLIP	22012620
MIRT526687	hsa-miR-8073	PAR-CLIP	22012620
MIRT526686	hsa-miR-6787-3p	PAR-CLIP	22012620
MIRT526685	hsa-miR-4680-5p	PAR-CLIP	22012620
MIRT494572	hsa-miR-4506	PAR-CLIP	23592263
MIRT494571	hsa-miR-3622a-3p	PAR-CLIP	23592263
MIRT494570	hsa-miR-3622b-3p	PAR-CLIP	23592263
MIRT494569	hsa-miR-6765-3p	PAR-CLIP	23592263
MIRT494568	hsa-miR-20b-3p	PAR-CLIP	23592263
MIRT494567	hsa-miR-412-3p	PAR-CLIP	23592263
MIRT494566	hsa-miR-6754-3p	PAR-CLIP	23592263
MIRT494565	hsa-miR-4790-3p	PAR-CLIP	23592263
MIRT494564	hsa-miR-6827-5p	PAR-CLIP	23592263
MIRT494563	hsa-miR-6090	PAR-CLIP	23592263
MIRT494562	hsa-miR-4300	PAR-CLIP	23592263
MIRT494560	hsa-miR-5591-5p	PAR-CLIP	23592263
MIRT494561	hsa-miR-6726-5p	PAR-CLIP	23592263
MIRT494559	hsa-miR-920	PAR-CLIP	23592263
MIRT494558	hsa-miR-92a-1-5p	PAR-CLIP	23592263
MIRT494557	hsa-miR-6073	PAR-CLIP	23592263
MIRT494556	hsa-miR-142-3p	PAR-CLIP	23592263
MIRT494555	hsa-miR-1257	PAR-CLIP	23592263
MIRT494554	hsa-miR-4425	PAR-CLIP	23592263
MIRT494553	hsa-miR-3606-5p	PAR-CLIP	23592263
MIRT494552	hsa-miR-30c-1-3p	PAR-CLIP	23592263
MIRT494551	hsa-miR-30c-2-3p	PAR-CLIP	23592263
MIRT494550	hsa-miR-6788-5p	PAR-CLIP	23592263
MIRT494549	hsa-miR-1273h-5p	PAR-CLIP	23592263
MIRT494548	hsa-miR-30b-3p	PAR-CLIP	23592263
MIRT494547	hsa-miR-3689a-3p	PAR-CLIP	23592263
MIRT494546	hsa-miR-3689b-3p	PAR-CLIP	23592263
MIRT494545	hsa-miR-3689c	PAR-CLIP	23592263
MIRT494543	hsa-miR-6779-5p	PAR-CLIP	23592263
MIRT494544	hsa-miR-6780a-5p	PAR-CLIP	23592263
MIRT494542	hsa-miR-3940-5p	PAR-CLIP	23592263
MIRT494541	hsa-miR-4507	PAR-CLIP	23592263
MIRT494540	hsa-miR-887-5p	PAR-CLIP	23592263
MIRT002394	hsa-miR-125b-5p	Luciferase reporter assay	27158338
MIRT494564	hsa-miR-6827-5p	PAR-CLIP	26701625
MIRT494564	hsa-miR-6827-5p	PAR-CLIP	26701625
MIRT568311	hsa-miR-92b-3p	PAR-CLIP	20371350
MIRT048976	hsa-miR-92a-3p	PAR-CLIP	20371350
MIRT568310	hsa-miR-367-3p	PAR-CLIP	20371350
MIRT568309	hsa-miR-363-3p	PAR-CLIP	20371350
MIRT568308	hsa-miR-25-3p	PAR-CLIP	20371350
MIRT568307	hsa-miR-32-5p	PAR-CLIP	20371350
MIRT568306	hsa-miR-3184-5p	PAR-CLIP	20371350
MIRT568305	hsa-miR-423-5p	PAR-CLIP	20371350
MIRT568304	hsa-miR-1914-3p	PAR-CLIP	20371350
MIRT568302	hsa-miR-5194	PAR-CLIP	20371350
MIRT568303	hsa-miR-6738-5p	PAR-CLIP	20371350
MIRT568301	hsa-miR-4450	PAR-CLIP	20371350
MIRT568300	hsa-miR-4710	PAR-CLIP	20371350
MIRT568299	hsa-miR-6734-5p	PAR-CLIP	20371350
MIRT568298	hsa-miR-3145-5p	PAR-CLIP	20371350
MIRT568311	hsa-miR-92b-3p	PAR-CLIP	20371350
MIRT048976	hsa-miR-92a-3p	PAR-CLIP	20371350
MIRT568310	hsa-miR-367-3p	PAR-CLIP	20371350
MIRT568309	hsa-miR-363-3p	PAR-CLIP	20371350
MIRT568308	hsa-miR-25-3p	PAR-CLIP	20371350
MIRT568307	hsa-miR-32-5p	PAR-CLIP	20371350
MIRT568306	hsa-miR-3184-5p	PAR-CLIP	20371350
MIRT568305	hsa-miR-423-5p	PAR-CLIP	20371350
MIRT568304	hsa-miR-1914-3p	PAR-CLIP	20371350
MIRT568302	hsa-miR-5194	PAR-CLIP	20371350
MIRT568303	hsa-miR-6738-5p	PAR-CLIP	20371350
MIRT568301	hsa-miR-4450	PAR-CLIP	20371350
MIRT568300	hsa-miR-4710	PAR-CLIP	20371350
MIRT568299	hsa-miR-6734-5p	PAR-CLIP	20371350
MIRT568298	hsa-miR-3145-5p	PAR-CLIP	20371350
MIRT526692	hsa-miR-1272	PAR-CLIP	22012620
MIRT526691	hsa-miR-1245b-3p	PAR-CLIP	22012620
MIRT526690	hsa-miR-4310	PAR-CLIP	22012620
MIRT526689	hsa-miR-7157-5p	PAR-CLIP	22012620
MIRT526688	hsa-miR-221-5p	PAR-CLIP	22012620
MIRT526687	hsa-miR-8073	PAR-CLIP	22012620
MIRT526686	hsa-miR-6787-3p	PAR-CLIP	22012620
MIRT526685	hsa-miR-4680-5p	PAR-CLIP	22012620
MIRT494572	hsa-miR-4506	PAR-CLIP	23592263
MIRT494571	hsa-miR-3622a-3p	PAR-CLIP	23592263
MIRT494570	hsa-miR-3622b-3p	PAR-CLIP	23592263
MIRT494569	hsa-miR-6765-3p	PAR-CLIP	23592263
MIRT494568	hsa-miR-20b-3p	PAR-CLIP	23592263
MIRT494567	hsa-miR-412-3p	PAR-CLIP	23592263
MIRT494566	hsa-miR-6754-3p	PAR-CLIP	23592263
MIRT494565	hsa-miR-4790-3p	PAR-CLIP	23592263
MIRT494564	hsa-miR-6827-5p	PAR-CLIP	23592263
MIRT494563	hsa-miR-6090	PAR-CLIP	23592263
MIRT494562	hsa-miR-4300	PAR-CLIP	23592263
MIRT494560	hsa-miR-5591-5p	PAR-CLIP	23592263
MIRT494561	hsa-miR-6726-5p	PAR-CLIP	23592263
MIRT494559	hsa-miR-920	PAR-CLIP	23592263
MIRT494558	hsa-miR-92a-1-5p	PAR-CLIP	23592263
MIRT494557	hsa-miR-6073	PAR-CLIP	23592263
MIRT494556	hsa-miR-142-3p	PAR-CLIP	23592263
MIRT494555	hsa-miR-1257	PAR-CLIP	23592263
MIRT494554	hsa-miR-4425	PAR-CLIP	23592263
MIRT494553	hsa-miR-3606-5p	PAR-CLIP	23592263
MIRT494552	hsa-miR-30c-1-3p	PAR-CLIP	23592263
MIRT494551	hsa-miR-30c-2-3p	PAR-CLIP	23592263
MIRT494550	hsa-miR-6788-5p	PAR-CLIP	23592263
MIRT494549	hsa-miR-1273h-5p	PAR-CLIP	23592263
MIRT494548	hsa-miR-30b-3p	PAR-CLIP	23592263
MIRT494547	hsa-miR-3689a-3p	PAR-CLIP	23592263
MIRT494546	hsa-miR-3689b-3p	PAR-CLIP	23592263
MIRT494545	hsa-miR-3689c	PAR-CLIP	23592263
MIRT494543	hsa-miR-6779-5p	PAR-CLIP	23592263
MIRT494544	hsa-miR-6780a-5p	PAR-CLIP	23592263
MIRT494542	hsa-miR-3940-5p	PAR-CLIP	23592263
MIRT494541	hsa-miR-4507	PAR-CLIP	23592263
MIRT494540	hsa-miR-887-5p	PAR-CLIP	23592263
MIRT815600	hsa-miR-1185	CLIP-seq
MIRT815601	hsa-miR-1224-3p	CLIP-seq
MIRT815602	hsa-miR-1227	CLIP-seq
MIRT815603	hsa-miR-125a-3p	CLIP-seq
MIRT815604	hsa-miR-125b	CLIP-seq
MIRT815605	hsa-miR-1260	CLIP-seq
MIRT815606	hsa-miR-1260b	CLIP-seq
MIRT815607	hsa-miR-1280	CLIP-seq
MIRT815608	hsa-miR-1321	CLIP-seq
MIRT815609	hsa-miR-1324	CLIP-seq
MIRT815610	hsa-miR-146a	CLIP-seq
MIRT815611	hsa-miR-146b-5p	CLIP-seq
MIRT815612	hsa-miR-1537	CLIP-seq
MIRT815613	hsa-miR-185	CLIP-seq
MIRT815614	hsa-miR-3126-5p	CLIP-seq
MIRT815615	hsa-miR-3150a-3p	CLIP-seq
MIRT815616	hsa-miR-3150b-3p	CLIP-seq
MIRT815617	hsa-miR-3166	CLIP-seq
MIRT815618	hsa-miR-3173-3p	CLIP-seq
MIRT815619	hsa-miR-3175	CLIP-seq
MIRT815620	hsa-miR-3192	CLIP-seq
MIRT815621	hsa-miR-326	CLIP-seq
MIRT815622	hsa-miR-330-5p	CLIP-seq
MIRT815623	hsa-miR-3614-3p	CLIP-seq
MIRT815624	hsa-miR-3679-5p	CLIP-seq
MIRT815625	hsa-miR-3925-5p	CLIP-seq
MIRT815626	hsa-miR-412	CLIP-seq
MIRT815627	hsa-miR-4257	CLIP-seq
MIRT815628	hsa-miR-4278	CLIP-seq
MIRT815629	hsa-miR-4305	CLIP-seq
MIRT815630	hsa-miR-4306	CLIP-seq
MIRT815631	hsa-miR-4314	CLIP-seq
MIRT815632	hsa-miR-4319	CLIP-seq
MIRT815633	hsa-miR-4419a	CLIP-seq
MIRT815634	hsa-miR-4428	CLIP-seq
MIRT815635	hsa-miR-4434	CLIP-seq
MIRT815636	hsa-miR-451	CLIP-seq
MIRT815637	hsa-miR-4510	CLIP-seq
MIRT815638	hsa-miR-4511	CLIP-seq
MIRT815639	hsa-miR-4516	CLIP-seq
MIRT815640	hsa-miR-4521	CLIP-seq
MIRT815641	hsa-miR-4644	CLIP-seq
MIRT815642	hsa-miR-4646-5p	CLIP-seq
MIRT815643	hsa-miR-4651	CLIP-seq
MIRT815644	hsa-miR-4661-3p	CLIP-seq
MIRT815645	hsa-miR-4667-5p	CLIP-seq
MIRT815646	hsa-miR-4689	CLIP-seq
MIRT815647	hsa-miR-4700-5p	CLIP-seq
MIRT815648	hsa-miR-4713-5p	CLIP-seq
MIRT815649	hsa-miR-4716-3p	CLIP-seq
MIRT815650	hsa-miR-4732-3p	CLIP-seq
MIRT815651	hsa-miR-4739	CLIP-seq
MIRT815652	hsa-miR-4751	CLIP-seq
MIRT815653	hsa-miR-4756-5p	CLIP-seq
MIRT815654	hsa-miR-4784	CLIP-seq
MIRT815655	hsa-miR-4795-5p	CLIP-seq
MIRT815656	hsa-miR-4802-5p	CLIP-seq
MIRT815657	hsa-miR-544b	CLIP-seq
MIRT815658	hsa-miR-552	CLIP-seq
MIRT815659	hsa-miR-608	CLIP-seq
MIRT815660	hsa-miR-637	CLIP-seq
MIRT815661	hsa-miR-647	CLIP-seq
MIRT815662	hsa-miR-769-5p	CLIP-seq
MIRT815663	hsa-miR-939	CLIP-seq
MIRT815603	hsa-miR-125a-3p	CLIP-seq
MIRT815604	hsa-miR-125b	CLIP-seq
MIRT1941282	hsa-miR-1286	CLIP-seq
MIRT815609	hsa-miR-1324	CLIP-seq
MIRT1941283	hsa-miR-24	CLIP-seq
MIRT815616	hsa-miR-3150b-3p	CLIP-seq
MIRT1941284	hsa-miR-3155	CLIP-seq
MIRT1941285	hsa-miR-3155b	CLIP-seq
MIRT1941286	hsa-miR-3176	CLIP-seq
MIRT1941287	hsa-miR-328	CLIP-seq
MIRT1941288	hsa-miR-3620	CLIP-seq
MIRT1941289	hsa-miR-3663-5p	CLIP-seq
MIRT1941290	hsa-miR-3922-3p	CLIP-seq
MIRT1941291	hsa-miR-3927	CLIP-seq
MIRT815629	hsa-miR-4305	CLIP-seq
MIRT815632	hsa-miR-4319	CLIP-seq
MIRT1941292	hsa-miR-4324	CLIP-seq
MIRT1941293	hsa-miR-4468	CLIP-seq
MIRT1941294	hsa-miR-4527	CLIP-seq
MIRT1941295	hsa-miR-4650-3p	CLIP-seq
MIRT815646	hsa-miR-4689	CLIP-seq
MIRT1941296	hsa-miR-4693-3p	CLIP-seq
MIRT815650	hsa-miR-4732-3p	CLIP-seq
MIRT1941297	hsa-miR-4757-5p	CLIP-seq
MIRT815654	hsa-miR-4784	CLIP-seq
MIRT1941298	hsa-miR-4796-5p	CLIP-seq
MIRT1941299	hsa-miR-484	CLIP-seq
MIRT1941300	hsa-miR-541	CLIP-seq
MIRT815657	hsa-miR-544b	CLIP-seq
MIRT815658	hsa-miR-552	CLIP-seq
MIRT1941301	hsa-miR-654-5p	CLIP-seq
MIRT1941302	hsa-miR-670	CLIP-seq
MIRT815662	hsa-miR-769-5p	CLIP-seq
MIRT815600	hsa-miR-1185	CLIP-seq
MIRT815603	hsa-miR-125a-3p	CLIP-seq
MIRT815604	hsa-miR-125b	CLIP-seq
MIRT815609	hsa-miR-1324	CLIP-seq
MIRT2180050	hsa-miR-1343	CLIP-seq
MIRT2180051	hsa-miR-1915	CLIP-seq
MIRT2180052	hsa-miR-2110	CLIP-seq
MIRT2180053	hsa-miR-296-5p	CLIP-seq
MIRT815616	hsa-miR-3150b-3p	CLIP-seq
MIRT2180054	hsa-miR-3180-5p	CLIP-seq
MIRT815623	hsa-miR-3614-3p	CLIP-seq
MIRT1941288	hsa-miR-3620	CLIP-seq
MIRT1941289	hsa-miR-3663-5p	CLIP-seq
MIRT815624	hsa-miR-3679-5p	CLIP-seq
MIRT2180055	hsa-miR-376c	CLIP-seq
MIRT1941291	hsa-miR-3927	CLIP-seq
MIRT815627	hsa-miR-4257	CLIP-seq
MIRT2180056	hsa-miR-4271	CLIP-seq
MIRT815628	hsa-miR-4278	CLIP-seq
MIRT2180057	hsa-miR-4286	CLIP-seq
MIRT2180058	hsa-miR-4292	CLIP-seq
MIRT2180059	hsa-miR-4301	CLIP-seq
MIRT815629	hsa-miR-4305	CLIP-seq
MIRT815632	hsa-miR-4319	CLIP-seq
MIRT1941292	hsa-miR-4324	CLIP-seq
MIRT2180060	hsa-miR-4437	CLIP-seq
MIRT1941294	hsa-miR-4527	CLIP-seq
MIRT1941295	hsa-miR-4650-3p	CLIP-seq
MIRT815643	hsa-miR-4651	CLIP-seq
MIRT815645	hsa-miR-4667-5p	CLIP-seq
MIRT2180061	hsa-miR-4674	CLIP-seq
MIRT815646	hsa-miR-4689	CLIP-seq
MIRT1941296	hsa-miR-4693-3p	CLIP-seq
MIRT815647	hsa-miR-4700-5p	CLIP-seq
MIRT815649	hsa-miR-4716-3p	CLIP-seq
MIRT2180062	hsa-miR-4725-3p	CLIP-seq
MIRT815650	hsa-miR-4732-3p	CLIP-seq
MIRT815654	hsa-miR-4784	CLIP-seq
MIRT2180063	hsa-miR-520a-5p	CLIP-seq
MIRT2180064	hsa-miR-525-5p	CLIP-seq
MIRT1941300	hsa-miR-541	CLIP-seq
MIRT815657	hsa-miR-544b	CLIP-seq
MIRT815658	hsa-miR-552	CLIP-seq
MIRT815659	hsa-miR-608	CLIP-seq
MIRT1941301	hsa-miR-654-5p	CLIP-seq
MIRT1941302	hsa-miR-670	CLIP-seq
MIRT815662	hsa-miR-769-5p	CLIP-seq
MIRT815609	hsa-miR-1324	CLIP-seq
MIRT815617	hsa-miR-3166	CLIP-seq
MIRT815618	hsa-miR-3173-3p	CLIP-seq
MIRT1941289	hsa-miR-3663-5p	CLIP-seq
MIRT815634	hsa-miR-4428	CLIP-seq
MIRT2384739	hsa-miR-4462	CLIP-seq
MIRT815640	hsa-miR-4521	CLIP-seq
MIRT1941294	hsa-miR-4527	CLIP-seq
MIRT815604	hsa-miR-125b	CLIP-seq
MIRT1941282	hsa-miR-1286	CLIP-seq
MIRT815608	hsa-miR-1321	CLIP-seq
MIRT2435619	hsa-miR-1909	CLIP-seq
MIRT2435620	hsa-miR-219-1-3p	CLIP-seq
MIRT2435621	hsa-miR-2682	CLIP-seq
MIRT2435622	hsa-miR-3132	CLIP-seq
MIRT2435623	hsa-miR-325	CLIP-seq
MIRT1941287	hsa-miR-328	CLIP-seq
MIRT2435624	hsa-miR-3714	CLIP-seq
MIRT815632	hsa-miR-4319	CLIP-seq
MIRT1941292	hsa-miR-4324	CLIP-seq
MIRT815633	hsa-miR-4419a	CLIP-seq
MIRT2435625	hsa-miR-4451	CLIP-seq
MIRT1941293	hsa-miR-4468	CLIP-seq
MIRT2435626	hsa-miR-449c	CLIP-seq
MIRT815637	hsa-miR-4510	CLIP-seq
MIRT1941296	hsa-miR-4693-3p	CLIP-seq
MIRT815650	hsa-miR-4732-3p	CLIP-seq
MIRT815651	hsa-miR-4739	CLIP-seq
MIRT2435627	hsa-miR-4743	CLIP-seq
MIRT815653	hsa-miR-4756-5p	CLIP-seq
MIRT2435628	hsa-miR-518a-5p	CLIP-seq
MIRT2435629	hsa-miR-527	CLIP-seq
MIRT2435630	hsa-miR-548an	CLIP-seq
MIRT1941302	hsa-miR-670	CLIP-seq
MIRT2483427	hsa-miR-122	CLIP-seq
MIRT815602	hsa-miR-1227	CLIP-seq
MIRT815603	hsa-miR-125a-3p	CLIP-seq
MIRT815604	hsa-miR-125b	CLIP-seq
MIRT2483428	hsa-miR-1275	CLIP-seq
MIRT2483429	hsa-miR-128	CLIP-seq
MIRT2483430	hsa-miR-1297	CLIP-seq
MIRT815608	hsa-miR-1321	CLIP-seq
MIRT815609	hsa-miR-1324	CLIP-seq
MIRT2483431	hsa-miR-1470	CLIP-seq
MIRT2435619	hsa-miR-1909	CLIP-seq
MIRT2180051	hsa-miR-1915	CLIP-seq
MIRT2435621	hsa-miR-2682	CLIP-seq
MIRT2483432	hsa-miR-26a	CLIP-seq
MIRT2483433	hsa-miR-26b	CLIP-seq
MIRT2483434	hsa-miR-27a	CLIP-seq
MIRT2483435	hsa-miR-27b	CLIP-seq
MIRT815614	hsa-miR-3126-5p	CLIP-seq
MIRT2435622	hsa-miR-3132	CLIP-seq
MIRT2483436	hsa-miR-3135b	CLIP-seq
MIRT2483437	hsa-miR-3144-5p	CLIP-seq
MIRT815616	hsa-miR-3150b-3p	CLIP-seq
MIRT2483438	hsa-miR-3182	CLIP-seq
MIRT2483439	hsa-miR-3184	CLIP-seq
MIRT2483440	hsa-miR-320a	CLIP-seq
MIRT2483441	hsa-miR-320b	CLIP-seq
MIRT2483442	hsa-miR-320c	CLIP-seq
MIRT2483443	hsa-miR-320d	CLIP-seq
MIRT2483444	hsa-miR-320e	CLIP-seq
MIRT2483445	hsa-miR-3606	CLIP-seq
MIRT815623	hsa-miR-3614-3p	CLIP-seq
MIRT1941288	hsa-miR-3620	CLIP-seq
MIRT1941289	hsa-miR-3663-5p	CLIP-seq
MIRT2483446	hsa-miR-3667-5p	CLIP-seq
MIRT2483447	hsa-miR-3686	CLIP-seq
MIRT2435624	hsa-miR-3714	CLIP-seq
MIRT2483448	hsa-miR-3922-5p	CLIP-seq
MIRT2483449	hsa-miR-3929	CLIP-seq
MIRT815626	hsa-miR-412	CLIP-seq
MIRT2483450	hsa-miR-4290	CLIP-seq
MIRT815629	hsa-miR-4305	CLIP-seq
MIRT815632	hsa-miR-4319	CLIP-seq
MIRT1941292	hsa-miR-4324	CLIP-seq
MIRT815633	hsa-miR-4419a	CLIP-seq
MIRT2483451	hsa-miR-4419b	CLIP-seq
MIRT2483452	hsa-miR-4429	CLIP-seq
MIRT2483453	hsa-miR-4447	CLIP-seq
MIRT2435625	hsa-miR-4451	CLIP-seq
MIRT2384739	hsa-miR-4462	CLIP-seq
MIRT2483454	hsa-miR-4465	CLIP-seq
MIRT2483455	hsa-miR-4472	CLIP-seq
MIRT2483456	hsa-miR-4478	CLIP-seq
MIRT2435626	hsa-miR-449c	CLIP-seq
MIRT815637	hsa-miR-4510	CLIP-seq
MIRT2483457	hsa-miR-4525	CLIP-seq
MIRT1941294	hsa-miR-4527	CLIP-seq
MIRT2483458	hsa-miR-4639-5p	CLIP-seq
MIRT815644	hsa-miR-4661-3p	CLIP-seq
MIRT2483459	hsa-miR-4665-5p	CLIP-seq
MIRT2483460	hsa-miR-4671-5p	CLIP-seq
MIRT815646	hsa-miR-4689	CLIP-seq
MIRT1941296	hsa-miR-4693-3p	CLIP-seq
MIRT2483461	hsa-miR-4723-5p	CLIP-seq
MIRT815650	hsa-miR-4732-3p	CLIP-seq
MIRT815651	hsa-miR-4739	CLIP-seq
MIRT2435627	hsa-miR-4743	CLIP-seq
MIRT815653	hsa-miR-4756-5p	CLIP-seq
MIRT815654	hsa-miR-4784	CLIP-seq
MIRT2483462	hsa-miR-4797-5p	CLIP-seq
MIRT815656	hsa-miR-4802-5p	CLIP-seq
MIRT2483463	hsa-miR-513a-5p	CLIP-seq
MIRT2435628	hsa-miR-518a-5p	CLIP-seq
MIRT2483464	hsa-miR-526b	CLIP-seq
MIRT2435629	hsa-miR-527	CLIP-seq
MIRT815657	hsa-miR-544b	CLIP-seq
MIRT2435630	hsa-miR-548an	CLIP-seq
MIRT815658	hsa-miR-552	CLIP-seq
MIRT2483465	hsa-miR-625	CLIP-seq
MIRT2483466	hsa-miR-645	CLIP-seq
MIRT1941302	hsa-miR-670	CLIP-seq
MIRT815662	hsa-miR-769-5p	CLIP-seq
MIRT2483427	hsa-miR-122	CLIP-seq
MIRT815601	hsa-miR-1224-3p	CLIP-seq
MIRT815602	hsa-miR-1227	CLIP-seq
MIRT815603	hsa-miR-125a-3p	CLIP-seq
MIRT815604	hsa-miR-125b	CLIP-seq
MIRT815605	hsa-miR-1260	CLIP-seq
MIRT815606	hsa-miR-1260b	CLIP-seq
MIRT2483428	hsa-miR-1275	CLIP-seq
MIRT2483429	hsa-miR-128	CLIP-seq
MIRT815607	hsa-miR-1280	CLIP-seq
MIRT1941282	hsa-miR-1286	CLIP-seq
MIRT2483430	hsa-miR-1297	CLIP-seq
MIRT815608	hsa-miR-1321	CLIP-seq
MIRT815609	hsa-miR-1324	CLIP-seq
MIRT2483431	hsa-miR-1470	CLIP-seq
MIRT2435619	hsa-miR-1909	CLIP-seq
MIRT2180051	hsa-miR-1915	CLIP-seq
MIRT2435620	hsa-miR-219-1-3p	CLIP-seq
MIRT2435621	hsa-miR-2682	CLIP-seq
MIRT2483432	hsa-miR-26a	CLIP-seq
MIRT2483433	hsa-miR-26b	CLIP-seq
MIRT2483434	hsa-miR-27a	CLIP-seq
MIRT2483435	hsa-miR-27b	CLIP-seq
MIRT815614	hsa-miR-3126-5p	CLIP-seq
MIRT2435622	hsa-miR-3132	CLIP-seq
MIRT2483436	hsa-miR-3135b	CLIP-seq
MIRT2483437	hsa-miR-3144-5p	CLIP-seq
MIRT815616	hsa-miR-3150b-3p	CLIP-seq
MIRT2483438	hsa-miR-3182	CLIP-seq
MIRT2483439	hsa-miR-3184	CLIP-seq
MIRT2483440	hsa-miR-320a	CLIP-seq
MIRT2483441	hsa-miR-320b	CLIP-seq
MIRT2483442	hsa-miR-320c	CLIP-seq
MIRT2483443	hsa-miR-320d	CLIP-seq
MIRT2483444	hsa-miR-320e	CLIP-seq
MIRT2483445	hsa-miR-3606	CLIP-seq
MIRT815623	hsa-miR-3614-3p	CLIP-seq
MIRT1941288	hsa-miR-3620	CLIP-seq
MIRT1941289	hsa-miR-3663-5p	CLIP-seq
MIRT2483447	hsa-miR-3686	CLIP-seq
MIRT2435624	hsa-miR-3714	CLIP-seq
MIRT2483448	hsa-miR-3922-5p	CLIP-seq
MIRT815626	hsa-miR-412	CLIP-seq
MIRT2483450	hsa-miR-4290	CLIP-seq
MIRT815629	hsa-miR-4305	CLIP-seq
MIRT815632	hsa-miR-4319	CLIP-seq
MIRT1941292	hsa-miR-4324	CLIP-seq
MIRT815633	hsa-miR-4419a	CLIP-seq
MIRT2483452	hsa-miR-4429	CLIP-seq
MIRT2483453	hsa-miR-4447	CLIP-seq
MIRT2435625	hsa-miR-4451	CLIP-seq
MIRT2384739	hsa-miR-4462	CLIP-seq
MIRT2483454	hsa-miR-4465	CLIP-seq
MIRT1941293	hsa-miR-4468	CLIP-seq
MIRT2483455	hsa-miR-4472	CLIP-seq
MIRT2435626	hsa-miR-449c	CLIP-seq
MIRT815637	hsa-miR-4510	CLIP-seq
MIRT2483457	hsa-miR-4525	CLIP-seq
MIRT1941294	hsa-miR-4527	CLIP-seq
MIRT2483458	hsa-miR-4639-5p	CLIP-seq
MIRT815644	hsa-miR-4661-3p	CLIP-seq
MIRT2483459	hsa-miR-4665-5p	CLIP-seq
MIRT2483460	hsa-miR-4671-5p	CLIP-seq
MIRT815646	hsa-miR-4689	CLIP-seq
MIRT1941296	hsa-miR-4693-3p	CLIP-seq
MIRT2483461	hsa-miR-4723-5p	CLIP-seq
MIRT815650	hsa-miR-4732-3p	CLIP-seq
MIRT815651	hsa-miR-4739	CLIP-seq
MIRT2435627	hsa-miR-4743	CLIP-seq
MIRT815653	hsa-miR-4756-5p	CLIP-seq
MIRT815654	hsa-miR-4784	CLIP-seq
MIRT1941298	hsa-miR-4796-5p	CLIP-seq
MIRT2483462	hsa-miR-4797-5p	CLIP-seq
MIRT815656	hsa-miR-4802-5p	CLIP-seq
MIRT2483463	hsa-miR-513a-5p	CLIP-seq
MIRT2435628	hsa-miR-518a-5p	CLIP-seq
MIRT2483464	hsa-miR-526b	CLIP-seq
MIRT2435629	hsa-miR-527	CLIP-seq
MIRT815657	hsa-miR-544b	CLIP-seq
MIRT2435630	hsa-miR-548an	CLIP-seq
MIRT815658	hsa-miR-552	CLIP-seq
MIRT2483465	hsa-miR-625	CLIP-seq
MIRT1941302	hsa-miR-670	CLIP-seq
MIRT815662	hsa-miR-769-5p	CLIP-seq

Transcription factors

Transcription factor	Regulation	Reference
WWTR1	Activation	22470139

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0001776	Process	Leukocyte homeostasis	IEA
GO:0001782	Process	B cell homeostasis	IEA
GO:0001783	Process	B cell apoptotic process	IEA
GO:0001836	Process	Release of cytochrome c from mitochondria	IBA
GO:0001836	Process	Release of cytochrome c from mitochondria	IDA	9843949, 16199525
GO:0001836	Process	Release of cytochrome c from mitochondria	IEA
GO:0001836	Process	Release of cytochrome c from mitochondria	IGI	21041309
GO:0001974	Process	Blood vessel remodeling	IEA
GO:0002262	Process	Myeloid cell homeostasis	IEA
GO:0002352	Process	B cell negative selection	IEA
GO:0005515	Function	Protein binding	IPI	9027312, 9111042, 9463381, 9843949, 10381623, 10950869, 11571294, 12624108, 14596824, 15901672, 16189514, 16439990, 17097560, 17289999, 17446862, 17606912, 18040043, 19060904, 19968986, 20023629, 21036904, 21132008, 22516262, 23055042, 23604079, 23680104, 23782464, 25416956, 2600468
GO:0005737	Component	Cytoplasm	IEA
GO:0005739	Component	Mitochondrion	HTP	34800366
GO:0005739	Component	Mitochondrion	IDA	9843949
GO:0005739	Component	Mitochondrion	IEA
GO:0005741	Component	Mitochondrial outer membrane	IBA
GO:0005741	Component	Mitochondrial outer membrane	IDA	22006182
GO:0005741	Component	Mitochondrial outer membrane	IDA	29531808, 32929280
GO:0005741	Component	Mitochondrial outer membrane	IEA
GO:0005741	Component	Mitochondrial outer membrane	ISS
GO:0005741	Component	Mitochondrial outer membrane	TAS
GO:0005783	Component	Endoplasmic reticulum	IEA
GO:0005829	Component	Cytosol	IEA
GO:0006915	Process	Apoptotic process	IDA	23028632
GO:0006915	Process	Apoptotic process	IEA
GO:0006915	Process	Apoptotic process	NAS	7715731
GO:0008053	Process	Mitochondrial fusion	IEA
GO:0008285	Process	Negative regulation of cell population proliferation	IEA
GO:0008630	Process	Intrinsic apoptotic signaling pathway in response to DNA damage	IBA
GO:0008630	Process	Intrinsic apoptotic signaling pathway in response to DNA damage	IEA
GO:0009410	Process	Response to xenobiotic stimulus	IEA
GO:0009620	Process	Response to fungus	IEA
GO:0010046	Process	Response to mycotoxin	IEA
GO:0010225	Process	Response to UV-C	IEA
GO:0010248	Process	Establishment or maintenance of transmembrane electrochemical gradient	IDA	9843949
GO:0010332	Process	Response to gamma radiation	IEA
GO:0010524	Process	Positive regulation of calcium ion transport into cytosol	IEA
GO:0010629	Process	Negative regulation of gene expression	IEA
GO:0015267	Function	Channel activity	IBA
GO:0015288	Function	Porin activity	IDA	22006182
GO:0016020	Component	Membrane	IEA
GO:0031018	Process	Endocrine pancreas development	IEA
GO:0031072	Function	Heat shock protein binding	IEA
GO:0031100	Process	Animal organ regeneration	IEA
GO:0031334	Process	Positive regulation of protein-containing complex assembly	IDA	9111042
GO:0031966	Component	Mitochondrial membrane	IEA
GO:0032469	Process	Endoplasmic reticulum calcium ion homeostasis	IEA
GO:0032469	Process	Endoplasmic reticulum calcium ion homeostasis	TAS	18309324
GO:0032471	Process	Negative regulation of endoplasmic reticulum calcium ion concentration	IEA
GO:0034220	Process	Monoatomic ion transmembrane transport	IEA
GO:0034620	Process	Cellular response to unfolded protein	TAS	22013210
GO:0034644	Process	Cellular response to UV	IEA
GO:0034644	Process	Cellular response to UV	IMP	15901672
GO:0034644	Process	Cellular response to UV	ISS
GO:0035108	Process	Limb morphogenesis	IEA
GO:0042542	Process	Response to hydrogen peroxide	IEA
GO:0042802	Function	Identical protein binding	IEA
GO:0042802	Function	Identical protein binding	IPI	10950869, 15901672, 16439990, 17024184, 17446862, 21041309, 23782464, 32929280
GO:0042803	Function	Protein homodimerization activity	IDA	23028632
GO:0042981	Process	Regulation of apoptotic process	IEA
GO:0043065	Process	Positive regulation of apoptotic process	IBA
GO:0043065	Process	Positive regulation of apoptotic process	IEA
GO:0043065	Process	Positive regulation of apoptotic process	IEA
GO:0043065	Process	Positive regulation of apoptotic process	IMP	17289999
GO:0043065	Process	Positive regulation of apoptotic process	ISS
GO:0044325	Function	Transmembrane transporter binding	IPI	25296756
GO:0044346	Process	Fibroblast apoptotic process	IEA
GO:0044877	Function	Protein-containing complex binding	IEA
GO:0045471	Process	Response to ethanol	IEA
GO:0045862	Process	Positive regulation of proteolysis	IDA	18387192
GO:0046872	Function	Metal ion binding	IEA
GO:0046902	Process	Regulation of mitochondrial membrane permeability	IDA	9843949, 21041309
GO:0046930	Component	Pore complex	IDA	9843949
GO:0046982	Function	Protein heterodimerization activity	IPI	10837489
GO:0048597	Process	Post-embryonic camera-type eye morphogenesis	IEA
GO:0048872	Process	Homeostasis of number of cells	IEA
GO:0050673	Process	Epithelial cell proliferation	IEA
GO:0051049	Process	Regulation of transport	IEA
GO:0051087	Function	Protein-folding chaperone binding	IEA
GO:0051400	Function	BH domain binding	IEA
GO:0051649	Process	Establishment of localization in cell	IEA
GO:0051726	Process	Regulation of cell cycle	IEA
GO:0051881	Process	Regulation of mitochondrial membrane potential	IDA	9843949
GO:0060068	Process	Vagina development	IEA
GO:0060402	Process	Calcium ion transport into cytosol	IEA
GO:0065008	Process	Regulation of biological quality	IEA
GO:0070059	Process	Intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress	IEA
GO:0070059	Process	Intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress	IEA
GO:0070059	Process	Intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress	TAS	22934019
GO:0070242	Process	Thymocyte apoptotic process	IEA
GO:0071260	Process	Cellular response to mechanical stimulus	IEP	19593445
GO:0090200	Process	Positive regulation of release of cytochrome c from mitochondria	IEA
GO:0090200	Process	Positive regulation of release of cytochrome c from mitochondria	NAS	32929280
GO:0090201	Process	Negative regulation of release of cytochrome c from mitochondria	IDA	15901672
GO:0097136	Component	Bcl-2 family protein complex	IDA	21041309
GO:0097136	Component	Bcl-2 family protein complex	IPI	22515821
GO:0097145	Component	BAK complex	IDA	10950869, 17024184, 23028632
GO:0097145	Component	BAK complex	IEA
GO:0097145	Component	BAK complex	IPI	32929280
GO:0097190	Process	Apoptotic signaling pathway	IMP	15901672
GO:0097192	Process	Extrinsic apoptotic signaling pathway in absence of ligand	IBA
GO:0097192	Process	Extrinsic apoptotic signaling pathway in absence of ligand	IEA
GO:0097193	Process	Intrinsic apoptotic signaling pathway	IC	10206961
GO:0097193	Process	Intrinsic apoptotic signaling pathway	IDA	22006182
GO:0097193	Process	Intrinsic apoptotic signaling pathway	IMP	15565177
GO:1901029	Process	Negative regulation of mitochondrial outer membrane permeabilization involved in apoptotic signaling pathway	IDA	15901672
GO:1901030	Process	Positive regulation of mitochondrial outer membrane permeabilization involved in apoptotic signaling pathway	NAS	32929280
GO:1902262	Process	Apoptotic process involved in blood vessel morphogenesis	IEA
GO:1902531	Process	Regulation of intracellular signal transduction	IEA
GO:1903896	Process	Positive regulation of IRE1-mediated unfolded protein response	TAS	22013210
GO:2001233	Process	Regulation of apoptotic signaling pathway	IEA

Other IDs

• MIM: 600516
• HGNC: 949
• e!Ensembl: ENSG00000030110

Protein

• UniProt ID: Q16611
• Protein name: Bcl-2 homologous antagonist/killer (Apoptosis regulator BAK) (Bcl-2-like protein 7) (Bcl2-L-7)
• Protein function: Plays a role in the mitochondrial apoptotic process. Upon arrival of cell death signals, promotes mitochondrial outer membrane (MOM) permeabilization by oligomerizing to form pores within the MOM. This releases apoptogenic factors into the cytos
• PDB: 1BXL, 2IMS, 2IMT, 2JBY, 2JCN, 2LP8, 2M5B, 2XPX, 2YV6, 3I1H, 3QBR, 4D2L, 4U2U, 4U2V, 4UF1, 5AJK, 5FMI, 5FMK, 5VWV, 5VWW, 5VWX, 5VWY, 5VWZ, 5VX0, 5VX1, 6ODH, 6UXM, 6UXN, 6UXO, 6UXP, 6UXQ, 6UXR, 7K02, 7LK4, 7M5A, 7M5B, 7OFM, 7OFO, 8CZF, 8CZG, 8CZH, 8GSV, 8IGC, 8IVB, 8SRX, 8SRY, 8UKY, 8Y1Y, 8Y1Z
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF00452	Bcl-2	78 → 177	Apoptosis regulator proteins, Bcl-2 family	Family

• Tissue specificity: TISSUE SPECIFICITY: Expressed in a wide variety of tissues, with highest levels in the heart and skeletal muscle.
• Sequence:

  MASGQGPGPPRQECGEPALPSASEEQVAQDTEEVFRSYVFYRHQQEQEAEGVAAPADPEM
  VTLPLQPSSTMGQVGRQLAIIGDDINRRYDSEFQTMLQHLQPTAENAYEYFTKIATSLFE
  SGINWGRVVALLGFGYRLALHVYQHGLTGFLGQVTRFVVDFMLHHCIARWIAQRGGWVAA
  LNLGNGPILNVLVVLGVVLLGQFVVRRFFKS

• Sequence length: 211

Pathways

KEGG:

Platinum drug resistance
Protein processing in endoplasmic reticulum
Apoptosis
Apoptosis - multiple species
Pathways of neurodegeneration - multiple diseases
Pathogenic Escherichia coli infection
Salmonella infection
Hepatitis C
Measles
Human cytomegalovirus infection
Influenza A
Human papillomavirus infection
Kaposi sarcoma-associated herpesvirus infection
Herpes simplex virus 1 infection
Epstein-Barr virus infection
Human immunodeficiency virus 1 infection
Pathways in cancer
Transcriptional misregulation in cancer
Viral carcinogenesis
MicroRNAs in cancer
Colorectal cancer
Pancreatic cancer
Endometrial cancer
Glioma
Thyroid cancer
Basal cell carcinoma
Melanoma
Chronic myeloid leukemia
Small cell lung cancer
Non-small cell lung cancer
Breast cancer
Hepatocellular carcinoma
Gastric cancer

Reactome:

Activation and oligomerization of BAK protein
Release of apoptotic factors from the mitochondria

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ATAXIA TELANGIECTASIA	—	Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
B-CELL ACUTE LYMPHOBLASTIC LEUKEMIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHAGAS CARDIOMYOPATHY	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CHRONIC LYMPHOCYTIC LEUKEMIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLONIC NEOPLASMS	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEMORRHAGIC DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HODGKINS LYMPHOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPOTHYROIDISM	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INSOMNIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
INTRACRANIAL GERM CELL TUMOR	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER NEOPLASMS, EXPERIMENTAL	—	CTD	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE MYELOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE SCLEROSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL INFARCTION	—	CTD, Disgenet CTD, Disgenet	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PRIMARY BILIARY CIRRHOSIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
RHEUMATOID ARTHRITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TESTICULAR CARCINOMA	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TESTICULAR GERM CELL TUMOR	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
THROMBOCYTOPENIA 4	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Acute lymphocytic leukemia	Lymphocytic Leukemia	BEFREE	31767839		★☆☆☆☆ Found in Text Mining only
Adenocarcinoma	Adenocarcinoma	BEFREE	12767516		★☆☆☆☆ Found in Text Mining only
Adenoma	Adenoma	BEFREE	8625322		★☆☆☆☆ Found in Text Mining only
Adult T-Cell Lymphoma/Leukemia	T-Cell Lymphoma/Leukemia	BEFREE	11042529		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	17712163	Stimulate	★☆☆☆☆ Found in Text Mining only
Anemia Refractory	Refractory anemia	Pubtator	12111784	Associate	★☆☆☆☆ Found in Text Mining only
Aortic Aneurysm, Abdominal	Aortic Aneurysm	BEFREE	19514060, 19935899		★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	27898717	Associate	★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	19282307, 29915899		★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune disease	Pubtator	9647638	Associate	★☆☆☆☆ Found in Text Mining only
Autoimmune Lymphoproliferative Syndrome	Autoimmune lymphoproliferative disorder	Pubtator	17218385, 23443079	Associate	★☆☆☆☆ Found in Text Mining only
B-Cell Lymphomas	B-Cell Lymphoma	BEFREE	21975296, 22171132, 28672809, 29033852, 29226557, 29375685, 30031796, 30175514, 30414993, 30940514, 31219428, 31323016		★☆☆☆☆ Found in Text Mining only
Barrett Esophagus	Barrett esophagus	Pubtator	30404157	Associate	★☆☆☆☆ Found in Text Mining only
Benign Neoplasm	Benign Neoplasm	BEFREE	11454518		★☆☆☆☆ Found in Text Mining only
Bipolar Disorder	Bipolar disorder	Pubtator	28463235	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Carcinoma	Breast Carcinoma	BEFREE	10800077, 20460378, 24672785, 28768804		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	11340162, 12841681, 23875900, 24672785, 26406239, 26503209, 26662313, 30592293, 32746451, 39300389	Associate	★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt lymphoma	Pubtator	23966164	Associate	★☆☆☆☆ Found in Text Mining only
Cap Myopathy	Cap myopathy	Pubtator	19414119	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	36594085	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma	Carcinoma	BEFREE	12771926, 8625322		★☆☆☆☆ Found in Text Mining only
Carcinoma Endometrioid	Endometrioid carcinoma	Pubtator	28937296	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	20850481, 23443079, 29653560, 33576217, 33602168, 36071875, 36769187, 37919059	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	10741712		★☆☆☆☆ Found in Text Mining only
Carcinoma Pancreatic Ductal	Pancreatic ductal carcinoma	Pubtator	29409480	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Renal Cell	Renal cell carcinoma	Pubtator	28154184, 32009115	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	12177802	Associate	★☆☆☆☆ Found in Text Mining only
Celiac Disease	Celiac disease	BEFREE	11908704		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	22700719, 30601084		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	GWASCAT_DG	22700719, 23770605, 28112199, 28165464		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	GWASDB_DG	22700719, 23770605		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colonic Neoplasms	Colonic Neoplasms	CTD_human_DG	18349538		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colonic Neoplasms	Colonic neoplasm	Pubtator	23966164	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Colorectal Carcinoma	Colorectal Cancer	BEFREE	10969770, 14654970, 27177325, 29374142		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	18593893, 19846965, 24574804, 24970817, 25156145, 29374142, 30066888	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	24030399	Stimulate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus Type 2	Diabetes mellitus, type 2	Pubtator	37538791	Associate	★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Insulin-Dependent	Diabetes Mellitus	BEFREE	29299204		★☆☆☆☆ Found in Text Mining only
Fibroid Tumor	Leiomyoma	LHGDN	11867266		★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	26555271		★☆☆☆☆ Found in Text Mining only
Focal glomerulosclerosis	Glomerulosclerosis	BEFREE	30389788		★☆☆☆☆ Found in Text Mining only
Glaucoma	Glaucoma	LHGDN	15638362		★☆☆☆☆ Found in Text Mining only
Glaucoma, Open-Angle	Glaucoma	BEFREE	30921274, 31166287		★☆☆☆☆ Found in Text Mining only
Glaucoma, Primary Open Angle	Glaucoma	BEFREE	29274019		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	24643683		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	24643683, 26125228, 35550147	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	24643683		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	19208740, 24811082	Associate	★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves Disease	LHGDN	15351796		★☆☆☆☆ Found in Text Mining only
Graves Disease	Graves disease	Pubtator	15351796	Associate	★☆☆☆☆ Found in Text Mining only
Hepatoblastoma	Hepatoblastoma	BEFREE	28349834		★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin disease	Pubtator	20090100	Associate	★☆☆☆☆ Found in Text Mining only
Hodgkin Disease	Hodgkin Disease	GWASCAT_DG	28112199		★☆☆☆☆ Found in Text Mining only
Hyperoxia	Hyperoxia	Pubtator	21128858	Stimulate	★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	18366759	Inhibit	★☆☆☆☆ Found in Text Mining only
Infertility Male	Male infertility	Pubtator	26056927	Associate	★☆☆☆☆ Found in Text Mining only
Intervertebral Disc Degeneration	Intervertebral Disc Degeneration	BEFREE	29299204		★☆☆☆☆ Found in Text Mining only
Intervertebral disc disorder	Intervertebral Disc Disorder	BEFREE	29299204		★☆☆☆☆ Found in Text Mining only
Intestinal Diseases	Intestinal disease	Pubtator	11908704	Associate	★☆☆☆☆ Found in Text Mining only
Ki-1+ Anaplastic Large Cell Lymphoma	Anaplastic Lymphoma	BEFREE	29581862		★☆☆☆☆ Found in Text Mining only
Laryngeal Neoplasms	Laryngeal neoplasm	Pubtator	23775802	Associate	★☆☆☆☆ Found in Text Mining only
Leiomyoma	Leiomyoma	Pubtator	16962107	Inhibit	★☆☆☆☆ Found in Text Mining only
leukemia	Leukemia	BEFREE	28700107		★☆☆☆☆ Found in Text Mining only
Leukemia	Leukemia	Pubtator	35563410	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia Myeloid Acute	Myeloid leukemia	Pubtator	19463775, 23798675, 26494789	Associate	★☆☆☆☆ Found in Text Mining only
Leukemia, Myelocytic, Acute	Leukemia	BEFREE	26494789, 28420723, 31801941		★☆☆☆☆ Found in Text Mining only
Leukemia, T-Cell	T-cell leukemia	BEFREE	11042529		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	23954442		★☆☆☆☆ Found in Text Mining only
Liver Neoplasms	Liver neoplasm	Pubtator	35562678	Associate	★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung Neoplasms	LHGDN	16410245		★☆☆☆☆ Found in Text Mining only
Lung Neoplasms	Lung neoplasms	Pubtator	19320642, 19381065, 38554387	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	BEFREE	16596195, 29504848, 30601084		★☆☆☆☆ Found in Text Mining only
Lymphoma	Lymphoma	Pubtator	29504848, 33883344, 34728569, 35563410	Associate	★☆☆☆☆ Found in Text Mining only
Lymphoproliferative Disorders	Lymphoproliferative Disorder	BEFREE	16988840		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	10800077, 20460378, 24672785, 28768804		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of gastrointestinal tract	Malignant gastrointestinal tract tumors	BEFREE	10969770, 15248898		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	10741712		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of pancreas	Pancreatic cancer	BEFREE	30260036		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	10969770, 14654970, 15248898		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	10706081, 10969770, 23255607, 31767839		★☆☆☆☆ Found in Text Mining only
Malignant Testicular Germ Cell Tumor	Malignant testicular germ cell tumor	GWASDB_DG	20543847		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	CTD_human_DG	18349538		★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	16528364, 16702969, 21158936, 22277029, 22705850, 31744894, 32054850	Associate	★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	LHGDN	16529740		★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	BEFREE	11135160		★☆☆☆☆ Found in Text Mining only
Mesothelioma	Mesothelioma	Pubtator	11135160	Associate	★☆☆☆☆ Found in Text Mining only
Mesothelioma Malignant	Mesothelioma	Pubtator	12063468	Associate	★☆☆☆☆ Found in Text Mining only
Mitochondrial Diseases	Mitochondrial disease	Pubtator	11696597, 16778220, 17218385, 18852132, 19010820, 22354970, 23108666, 23254292, 26503209, 28154184, 37055388	Associate	★☆☆☆☆ Found in Text Mining only
Multiple Myeloma	Multiple myeloma	GWASCAT_DG	28112199		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Myelodysplastic Syndromes	Myelodysplastic syndrome	Pubtator	12111784	Associate	★☆☆☆☆ Found in Text Mining only
Myocardial Infarction	Myocardial Infarction	CTD_human_DG	29122578		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Nasopharyngeal carcinoma	Nasopharyngeal Carcinoma	GWASDB_DG	20512145		★☆☆☆☆ Found in Text Mining only
Nasopharyngeal Carcinoma	Nasopharyngeal carcinoma	Pubtator	22526391	Associate	★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	12538456, 21880154, 25617717, 30714136		★☆☆☆☆ Found in Text Mining only
Nephroblastoma	Nephroblastoma	BEFREE	22244202		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	17991745, 19740541		★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	23339468	Associate	★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	21706479, 24532468		★☆☆☆☆ Found in Text Mining only
Ocular Hypertension	Ocular Hypertension	BEFREE	30921274, 31166287		★☆☆☆☆ Found in Text Mining only
Osteoarthritis, Knee	Knee osteoarthritis	BEFREE	28859619		★☆☆☆☆ Found in Text Mining only
Osteoporosis	Osteoporosis	Pubtator	39778696	Associate	★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	Pubtator	26416351, 34335109	Associate	★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	22683989	Associate	★☆☆☆☆ Found in Text Mining only
Pancreatic carcinoma	Pancreatic carcinoma	BEFREE	30260036		★☆☆☆☆ Found in Text Mining only
Pancreatic Neoplasms	Pancreatic neoplasm	Pubtator	18413764	Associate	★☆☆☆☆ Found in Text Mining only
Paramyotonia Congenita (disorder)	Paramyotonia Congenita	BEFREE	22076676		★☆☆☆☆ Found in Text Mining only
Primary Myelofibrosis	Myelofibrosis	BEFREE	22300941		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	16794010, 17513609, 18056640, 18668529	Associate	★☆☆☆☆ Found in Text Mining only
Pulmonary Disease Chronic Obstructive	Chronic obstructive pulmonary disease	Pubtator	22686245	Associate	★☆☆☆☆ Found in Text Mining only
Rectal Carcinoma	Rectal Carcinoma	BEFREE	22171132		★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	16988840, 29915899		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcopenia	Sarcopenia	Pubtator	32226296	Associate	★☆☆☆☆ Found in Text Mining only
Sepsis	Sepsis	Pubtator	36443881	Associate	★☆☆☆☆ Found in Text Mining only
Sjogren's Syndrome	Sjogren syndrome	Pubtator	29504848	Associate	★☆☆☆☆ Found in Text Mining only
Small Lymphocytic Lymphoma	Lymphocytic Leukemia	GWASCAT_DG	22700719, 23770605, 28112199, 28165464		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	BEFREE	10193941		★☆☆☆☆ Found in Text Mining only
Squamous cell carcinoma	Carcinoma	LHGDN	15638360		★☆☆☆☆ Found in Text Mining only
Squamous Cell Carcinoma of Head and Neck	Squamous cell carcinoma	Pubtator	25139387, 25186767, 31894587, 34894384, 40302074	Associate	★☆☆☆☆ Found in Text Mining only
Stomach Carcinoma	Stomach Carcinoma	BEFREE	15248898		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach Neoplasms	LHGDN	15248898		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	15248898, 21777278, 32993565, 40076652	Associate	★☆☆☆☆ Found in Text Mining only
Testicular Diseases	Testicular disease	Pubtator	35918310	Associate	★☆☆☆☆ Found in Text Mining only
Testicular Germ Cell Tumor	Testicular Germ Cell Tumor	GWASDB_DG	19483681, 23666239, 23666240		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Testicular Germ Cell Tumor	Testicular germ cell tumor	Pubtator	21551455, 21617256, 30027931	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Testicular Germ Cell Tumor	Testicular Germ Cell Tumor	BEFREE	23640991		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Testicular Germ Cell Tumor	Testicular Germ Cell Tumor	GWASCAT_DG	28604728, 28604732		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Testicular Neoplasms	Testicular Neoplasms	GWASCAT_DG	19483681, 23666239, 23666240		★☆☆☆☆ Found in Text Mining only
Testicular Neoplasms	Testicular neoplasm	Pubtator	21564132, 28295819	Associate	★☆☆☆☆ Found in Text Mining only
Testicular Neoplasms	Testicular Neoplasms	BEFREE	28295819		★☆☆☆☆ Found in Text Mining only
Thrombocythemia Essential	Essential thrombocythemia	Pubtator	22300941	Associate	★☆☆☆☆ Found in Text Mining only
Thrombocythemia, Essential	Thrombocythemia	BEFREE	22300941		★☆☆☆☆ Found in Text Mining only
Thyroid Cancer Papillary	Papillary thyroid cancer	Pubtator	21642358	Associate	★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	LHGDN	14647456		★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	25617717		★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple Negative Breast Neoplasms	BEFREE	29374168		★☆☆☆☆ Found in Text Mining only
Uterine Cervical Neoplasms	Uterine neoplasm	Pubtator	12771926, 23928699	Associate	★☆☆☆☆ Found in Text Mining only
Uterine Fibroids	Uterine Fibroids	BEFREE	11867266		★☆☆☆☆ Found in Text Mining only
Waldenstrom Macroglobulinemia	Waldenstrom macroglobulinemia	Pubtator	25893290	Associate	★☆☆☆☆ Found in Text Mining only