SUGP1 (SURP and G-patch domain containing 1)

Gene

• Entrez ID: 57794
• Gene name: SURP and G-patch domain containing 1
• Gene symbol: SUGP1
• Synonyms (NCBI Gene): F23858, RBP, SF4
• Chromosome: 19
• Chromosome location: 19p13.11
• Summary: SF4 is a member of the SURP family of splicing factors.[supplied by OMIM, Sep 2003]

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT023869	hsa-miR-1-3p	Proteomics;Microarray	18668037
MIRT049813	hsa-miR-92a-3p	CLASH	23622248
MIRT696466	hsa-miR-106a-5p	HITS-CLIP	23313552
MIRT696465	hsa-miR-106b-5p	HITS-CLIP	23313552
MIRT696464	hsa-miR-17-5p	HITS-CLIP	23313552
MIRT696463	hsa-miR-20a-5p	HITS-CLIP	23313552
MIRT696462	hsa-miR-20b-5p	HITS-CLIP	23313552
MIRT696461	hsa-miR-519d-3p	HITS-CLIP	23313552
MIRT696460	hsa-miR-526b-3p	HITS-CLIP	23313552
MIRT696459	hsa-miR-93-5p	HITS-CLIP	23313552
MIRT696458	hsa-miR-302a-3p	HITS-CLIP	23313552
MIRT696457	hsa-miR-302b-3p	HITS-CLIP	23313552
MIRT696456	hsa-miR-302c-3p	HITS-CLIP	23313552
MIRT696455	hsa-miR-302d-3p	HITS-CLIP	23313552
MIRT696454	hsa-miR-302e	HITS-CLIP	23313552
MIRT696453	hsa-miR-372-3p	HITS-CLIP	23313552
MIRT696452	hsa-miR-373-3p	HITS-CLIP	23313552
MIRT696451	hsa-miR-520a-3p	HITS-CLIP	23313552
MIRT696450	hsa-miR-520b	HITS-CLIP	23313552
MIRT696449	hsa-miR-520c-3p	HITS-CLIP	23313552
MIRT696448	hsa-miR-520d-3p	HITS-CLIP	23313552
MIRT696447	hsa-miR-520e	HITS-CLIP	23313552
MIRT696446	hsa-miR-512-3p	HITS-CLIP	23313552
MIRT696445	hsa-miR-3973	HITS-CLIP	23313552
MIRT696444	hsa-miR-520g-3p	HITS-CLIP	23313552
MIRT696443	hsa-miR-520h	HITS-CLIP	23313552
MIRT696442	hsa-miR-212-5p	HITS-CLIP	23313552
MIRT696441	hsa-miR-371b-5p	HITS-CLIP	23313552
MIRT696440	hsa-miR-373-5p	HITS-CLIP	23313552
MIRT696439	hsa-miR-616-5p	HITS-CLIP	23313552
MIRT696438	hsa-miR-371a-5p	HITS-CLIP	23313552
MIRT696437	hsa-miR-372-5p	HITS-CLIP	23313552
MIRT696436	hsa-miR-619-5p	HITS-CLIP	23313552
MIRT696435	hsa-miR-6506-5p	HITS-CLIP	23313552
MIRT696434	hsa-miR-4707-3p	HITS-CLIP	23313552
MIRT696433	hsa-miR-4731-5p	HITS-CLIP	23313552
MIRT696432	hsa-miR-5589-5p	HITS-CLIP	23313552
MIRT696431	hsa-miR-6744-5p	HITS-CLIP	23313552
MIRT696430	hsa-miR-4757-5p	HITS-CLIP	23313552
MIRT696429	hsa-miR-6744-3p	HITS-CLIP	23313552
MIRT696428	hsa-miR-5187-5p	HITS-CLIP	23313552
MIRT696427	hsa-miR-6878-3p	HITS-CLIP	23313552
MIRT696426	hsa-miR-6728-5p	HITS-CLIP	23313552
MIRT696466	hsa-miR-106a-5p	HITS-CLIP	23313552
MIRT696465	hsa-miR-106b-5p	HITS-CLIP	23313552
MIRT696464	hsa-miR-17-5p	HITS-CLIP	23313552
MIRT696463	hsa-miR-20a-5p	HITS-CLIP	23313552
MIRT696462	hsa-miR-20b-5p	HITS-CLIP	23313552
MIRT696461	hsa-miR-519d-3p	HITS-CLIP	23313552
MIRT696460	hsa-miR-526b-3p	HITS-CLIP	23313552
MIRT696459	hsa-miR-93-5p	HITS-CLIP	23313552
MIRT696458	hsa-miR-302a-3p	HITS-CLIP	23313552
MIRT696457	hsa-miR-302b-3p	HITS-CLIP	23313552
MIRT696456	hsa-miR-302c-3p	HITS-CLIP	23313552
MIRT696455	hsa-miR-302d-3p	HITS-CLIP	23313552
MIRT696454	hsa-miR-302e	HITS-CLIP	23313552
MIRT696453	hsa-miR-372-3p	HITS-CLIP	23313552
MIRT696452	hsa-miR-373-3p	HITS-CLIP	23313552
MIRT696451	hsa-miR-520a-3p	HITS-CLIP	23313552
MIRT696450	hsa-miR-520b	HITS-CLIP	23313552
MIRT696449	hsa-miR-520c-3p	HITS-CLIP	23313552
MIRT696448	hsa-miR-520d-3p	HITS-CLIP	23313552
MIRT696447	hsa-miR-520e	HITS-CLIP	23313552
MIRT696446	hsa-miR-512-3p	HITS-CLIP	23313552
MIRT696445	hsa-miR-3973	HITS-CLIP	23313552
MIRT696444	hsa-miR-520g-3p	HITS-CLIP	23313552
MIRT696443	hsa-miR-520h	HITS-CLIP	23313552
MIRT696442	hsa-miR-212-5p	HITS-CLIP	23313552
MIRT696441	hsa-miR-371b-5p	HITS-CLIP	23313552
MIRT696440	hsa-miR-373-5p	HITS-CLIP	23313552
MIRT696439	hsa-miR-616-5p	HITS-CLIP	23313552
MIRT696438	hsa-miR-371a-5p	HITS-CLIP	23313552
MIRT696437	hsa-miR-372-5p	HITS-CLIP	23313552
MIRT696436	hsa-miR-619-5p	HITS-CLIP	23313552
MIRT696435	hsa-miR-6506-5p	HITS-CLIP	23313552
MIRT696434	hsa-miR-4707-3p	HITS-CLIP	23313552
MIRT696433	hsa-miR-4731-5p	HITS-CLIP	23313552
MIRT696432	hsa-miR-5589-5p	HITS-CLIP	23313552
MIRT696431	hsa-miR-6744-5p	HITS-CLIP	23313552
MIRT696430	hsa-miR-4757-5p	HITS-CLIP	23313552
MIRT696429	hsa-miR-6744-3p	HITS-CLIP	23313552
MIRT696428	hsa-miR-5187-5p	HITS-CLIP	23313552
MIRT696427	hsa-miR-6878-3p	HITS-CLIP	23313552
MIRT696426	hsa-miR-6728-5p	HITS-CLIP	23313552
MIRT1402512	hsa-miR-191	CLIP-seq
MIRT1402513	hsa-miR-3177-3p	CLIP-seq
MIRT1402514	hsa-miR-3179	CLIP-seq
MIRT1402515	hsa-miR-3199	CLIP-seq
MIRT1402516	hsa-miR-3202	CLIP-seq
MIRT1402517	hsa-miR-3663-3p	CLIP-seq
MIRT1402518	hsa-miR-3936	CLIP-seq
MIRT1402519	hsa-miR-4504	CLIP-seq
MIRT1402520	hsa-miR-4636	CLIP-seq
MIRT1402521	hsa-miR-4651	CLIP-seq
MIRT1402522	hsa-miR-541	CLIP-seq
MIRT1402523	hsa-miR-549	CLIP-seq
MIRT1402524	hsa-miR-556-3p	CLIP-seq
MIRT1402525	hsa-miR-564	CLIP-seq
MIRT1402526	hsa-miR-602	CLIP-seq
MIRT1402527	hsa-miR-608	CLIP-seq
MIRT1402528	hsa-miR-654-5p	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003676	Function	Nucleic acid binding	IEA
GO:0003723	Function	RNA binding	HDA	22681889
GO:0003723	Function	RNA binding	IBA
GO:0003723	Function	RNA binding	IEA
GO:0003729	Function	MRNA binding	IEA
GO:0005515	Function	Protein binding	IPI	21988832, 22365833, 35271311, 39251607
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IBA
GO:0005654	Component	Nucleoplasm	IDA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005681	Component	Spliceosomal complex	IEA
GO:0006396	Process	RNA processing	IEA
GO:0006397	Process	MRNA processing	IEA
GO:0008380	Process	RNA splicing	IEA

Other IDs

• MIM: 607992
• HGNC: 18643
• e!Ensembl: ENSG00000105705

Protein

• UniProt ID: Q8IWZ8
• Protein name: SURP and G-patch domain-containing protein 1 (RNA-binding protein RBP) (Splicing factor 4)
• Protein function: Plays a role in pre-mRNA splicing.
• PDB: 8EJM, 8GXL, 8GXM
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF01805	Surp	189 → 241	Surp module	Family
  PF01805	Surp	264 → 316	Surp module	Family
  PF01585	G-patch	562 → 607	G-patch domain	Family

• Tissue specificity: TISSUE SPECIFICITY: Detected in adult testis and heart, and in adult and fetal brain, kidney and skeletal muscle. {ECO:0000269|PubMed:12594045}.
• Sequence:

  MSLKMDNRDVAGKANRWFGVAPPKSGKMNMNILHQEELIAQKKREIEAKMEQKAKQNQVA
  SPQPPHPGEITNAHNSSCISNKFANDGSFLQQFLKLQKAQTSTDAPTSAPSAPPSTPTPS
  AGKRSLLISRRTGLGLASLPGPVKSYSHAKQLPVAHRPSVFQSPDEDEEEDYEQWLEIKV
  SPPEGAETRKVIEKLARFVAEGGPELEKVAMEDYKDNPAFAFLHDKNSREFLYYRKKVAE
  IRKEAQKSQAASQKVSPPEDEEVKNLAEKLARFIADGGPEVETIALQNNRENQAFSFLYE
  PNSQGYKYYRQKLEEFRKAKASSTGSFTAPDPGLKRKSPPEALSGSLPPATTCPASSTPA
  PTIIPAPAAPGKPASAATVKRKRKSRWGPEEDKVELPPAELVQRDVDASPSPLSVQDLKG
  LGYEKGKPVGLVGVTELSDAQKKQLKEQQEMQQMYDMIMQHKRAMQDMQLLWEKAVQQHQ
  HGYDSDEEVDSELGTWEHQLRRMEMDKTREWAEQLTKMGRGKHFIGDFLPPDELEKFMET
  FKALKEGREPDYSEYKEFKLTVENIGYQMLMKMGWKEGEGLGSEGQGIKNPVNKGTTTVD
  GAGFGIDRPAELSKEDDEYEAFRKRMMLAYRFRPNPLNNPRRPYY

• Sequence length: 645

Pathways

Reactome:

mRNA Splicing - Major Pathway

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ATRIAL FIBRILLATION	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CIRRHOSIS OF LIVER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIABETIC EYE DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEART FAILURE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LIVER NEOPLASM	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MIGRAINE DISORDER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-ALCOHOLIC FATTY LIVER DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-ALCOHOLIC STEATOHEPATITIS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
STROKE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Adult T-Cell Lymphoma/Leukemia	T-Cell Lymphoma/Leukemia	BEFREE	9111040		★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	33271327	Associate	★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic Lateral Sclerosis	BEFREE	22028183, 23389473, 27378374		★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis	Amyotrophic lateral sclerosis	Pubtator	29134320, 37011198	Associate	★☆☆☆☆ Found in Text Mining only
Amyotrophic Lateral Sclerosis, Sporadic	Lateral Sclerosis	BEFREE	22028183		★☆☆☆☆ Found in Text Mining only
Arthritis Rheumatoid	Rheumatoid arthritis	Pubtator	16260763	Associate	★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial Fibrillation	GWASCAT_DG	27790247		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Autoimmune Diseases	Autoimmune Diseases	BEFREE	24840980, 29244194		★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	23421905		★☆☆☆☆ Found in Text Mining only
Breast Neoplasms	Breast neoplasm	Pubtator	36722268	Associate	★☆☆☆☆ Found in Text Mining only
Burkitt Lymphoma	Burkitt lymphoma	Pubtator	9878621	Associate	★☆☆☆☆ Found in Text Mining only
CADASIL	Cadasil	Pubtator	14714274	Associate	★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	31039132, 32059763, 33287884, 35194031	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	28231410, 30153342, 33297932, 33524497, 34656649	Associate	★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	30918328		★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	27186987, 36516959	Associate	★☆☆☆☆ Found in Text Mining only
Cardiomyopathy, Familial Idiopathic	Cardiomyopathy	BEFREE	10600520		★☆☆☆☆ Found in Text Mining only
Cardiovascular Diseases	Cardiovascular disease	Pubtator	35848884	Associate	★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	GWASCAT_DG	27790247		★☆☆☆☆ Found in Text Mining only
Choriocarcinoma	Choriocarcinoma	BEFREE	23284704		★☆☆☆☆ Found in Text Mining only
Chronic Lymphocytic Leukemia	Lymphocytic Leukemia	BEFREE	30467111		★☆☆☆☆ Found in Text Mining only
Colon Carcinoma	Colon Carcinoma	BEFREE	28373441, 31487531		★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	19734850, 36895014	Associate	★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	BEFREE	27206982		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary heart disease	Coronary Heart Disease	GWASDB_DG	21347282		★☆☆☆☆ Found in Text Mining only
Coronary heart disease	Coronary Heart Disease	GWASCAT_DG	27790247		★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	GWASCAT_DG	27790247		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	GWASCAT_DG	27790247		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus	Diabetes mellitus	Pubtator	34656649	Associate	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	GWASCAT_DG	22885922, 30054458		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	GWASDB_DG	22885922		★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	28733465		★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	26234674		★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	26234674		★☆☆☆☆ Found in Text Mining only
Fatty Liver	Fatty Liver	BEFREE	25246029		★☆☆☆☆ Found in Text Mining only
Fibrosis, Liver	Liver Fibrosis	BEFREE	25587629		★☆☆☆☆ Found in Text Mining only
Frontotemporal Lobar Degeneration	Frontotemporal dementia	BEFREE	23389473		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	22258704		★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	28035070, 35049227	Associate	★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	22258704, 23421905		★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	28035070	Associate	★☆☆☆☆ Found in Text Mining only
Heart failure	Heart Failure	GWASCAT_DG	27790247		★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hyperlipidemias	Hyperlipidemia	Pubtator	32568739	Associate	★☆☆☆☆ Found in Text Mining only
Ischemic cardiomyopathy	Ischemic myocardial dysfunction	BEFREE	10600520		★☆☆☆☆ Found in Text Mining only
Kaposi Sarcoma	Kaposi Sarcoma	BEFREE	16254371, 16728959		★☆☆☆☆ Found in Text Mining only
Kidney Failure, Acute	Kidney Failure	BEFREE	28011057		★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	2998779, 30014619, 3034601		★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis Alcoholic	Liver cirrhosis	Pubtator	34656649	Associate	★☆☆☆☆ Found in Text Mining only
Liver Cirrhosis, Alcoholic	Alcoholic Liver Cirrhosis	GWASCAT_DG	26482880		★☆☆☆☆ Found in Text Mining only
Liver Diseases Alcoholic	Liver disease	Pubtator	30589442	Associate	★☆☆☆☆ Found in Text Mining only
Liver neoplasms	Liver neoplasms	BEFREE	2998779, 3034601		★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Discoid	Discoid lupus erythematosus	Pubtator	34083207	Associate	★☆☆☆☆ Found in Text Mining only
Lupus Erythematosus Systemic	Systemic lupus erythematosus	Pubtator	15880830, 34083207	Associate	★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	26234674		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	30918328		★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	BEFREE	20110258, 26310125, 27102850		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	22201732, 28231410, 28443890, 28969093, 29393503, 31365778, 31492682		★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	GWASCAT_DG	27790247		★☆☆☆☆ Found in Text Mining only
Malignant tumor of colon	Colonic Neoplasms	BEFREE	28373441, 31487531		★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	BEFREE	30190085, 31755578		★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	30084199		★☆☆☆☆ Found in Text Mining only
Neurodegenerative Diseases	Neurodegenerative disorder	Pubtator	28467899, 30937520	Associate	★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	23389473, 28392367, 30190085, 31755578		★☆☆☆☆ Found in Text Mining only
Neuromuscular Diseases	Neuromuscular disease	Pubtator	37011198	Associate	★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	GWASCAT_DG	25246029		★☆☆☆☆ Found in Text Mining only
Osteoarthritis	Osteoarthritis	Pubtator	36641761	Associate	★☆☆☆☆ Found in Text Mining only
Parkinson Disease	Parkinson disease	Pubtator	33271327	Associate	★☆☆☆☆ Found in Text Mining only
Periodontitis	Periodontitis	Pubtator	34285922	Associate	★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	BEFREE	20110258, 26310125, 27102850		★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic neoplasm	Pubtator	27102850, 32882325	Associate	★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	28939941		★☆☆☆☆ Found in Text Mining only
Sarcoma	Sarcoma	Pubtator	28701145	Associate	★☆☆☆☆ Found in Text Mining only
Schizophrenia	Schizophrenia	BEFREE	23868656		★☆☆☆☆ Found in Text Mining only
Steatohepatitis	Fatty Liver	BEFREE	25246029		★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	34413861	Associate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	32724453	Associate	★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	39392600	Associate	★☆☆☆☆ Found in Text Mining only
Vision Disorders	Visual disorder	Pubtator	26325091	Associate	★☆☆☆☆ Found in Text Mining only