Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	57787
Gene name	Microtubule affinity regulating kinase 4
Gene symbol	MARK4
Synonyms (NCBI Gene)	MARK4LMARK4SMARKL1MARKL1LPAR-1D
Chromosome	19
Chromosome location	19q13.32
Summary	This gene encodes a member of the microtubule affinity-regulating kinase family. These protein kinases phosphorylate microtubule-associated proteins and regulate the transition between stable and dynamic microtubules. The encoded protein is associated wit

188

Show/Hide all (188)

miRTarBase ID	miRNA	Experiments	Reference
MIRT018631	hsa-miR-335-5p	Microarray	18185580
MIRT047961	hsa-miR-30c-5p	CLASH	23622248
MIRT723892	hsa-miR-3675-3p	HITS-CLIP	19536157
MIRT723891	hsa-miR-7108-3p	HITS-CLIP	19536157
MIRT723890	hsa-miR-3162-3p	HITS-CLIP	19536157
MIRT723889	hsa-miR-4684-5p	HITS-CLIP	19536157
MIRT723888	hsa-miR-3685	HITS-CLIP	19536157
MIRT723892	hsa-miR-3675-3p	HITS-CLIP	19536157
MIRT723891	hsa-miR-7108-3p	HITS-CLIP	19536157
MIRT723890	hsa-miR-3162-3p	HITS-CLIP	19536157
MIRT723889	hsa-miR-4684-5p	HITS-CLIP	19536157
MIRT723888	hsa-miR-3685	HITS-CLIP	19536157
MIRT1132697	hsa-miR-1207-5p	CLIP-seq
MIRT1132698	hsa-miR-1237	CLIP-seq
MIRT1132699	hsa-miR-1252	CLIP-seq
MIRT1132700	hsa-miR-1255a	CLIP-seq
MIRT1132701	hsa-miR-1255b	CLIP-seq
MIRT1132702	hsa-miR-125a-3p	CLIP-seq
MIRT1132703	hsa-miR-136	CLIP-seq
MIRT1132704	hsa-miR-2467-3p	CLIP-seq
MIRT1132705	hsa-miR-298	CLIP-seq
MIRT1132706	hsa-miR-3120-3p	CLIP-seq
MIRT1132707	hsa-miR-3121-5p	CLIP-seq
MIRT1132708	hsa-miR-3127-3p	CLIP-seq
MIRT1132709	hsa-miR-3135b	CLIP-seq
MIRT1132710	hsa-miR-3144-5p	CLIP-seq
MIRT1132711	hsa-miR-3151	CLIP-seq
MIRT1132712	hsa-miR-3158-5p	CLIP-seq
MIRT1132713	hsa-miR-3191	CLIP-seq
MIRT1132714	hsa-miR-3194-5p	CLIP-seq
MIRT1132715	hsa-miR-320a	CLIP-seq
MIRT1132716	hsa-miR-320b	CLIP-seq
MIRT1132717	hsa-miR-320c	CLIP-seq
MIRT1132718	hsa-miR-320d	CLIP-seq
MIRT1132719	hsa-miR-320e	CLIP-seq
MIRT1132720	hsa-miR-3616-3p	CLIP-seq
MIRT1132721	hsa-miR-3649	CLIP-seq
MIRT1132722	hsa-miR-3665	CLIP-seq
MIRT1132723	hsa-miR-3678-3p	CLIP-seq
MIRT1132724	hsa-miR-3681	CLIP-seq
MIRT1132725	hsa-miR-3691-5p	CLIP-seq
MIRT1132726	hsa-miR-3919	CLIP-seq
MIRT1132727	hsa-miR-3925-5p	CLIP-seq
MIRT1132728	hsa-miR-4303	CLIP-seq
MIRT1132729	hsa-miR-4310	CLIP-seq
MIRT1132730	hsa-miR-4313	CLIP-seq
MIRT1132731	hsa-miR-4429	CLIP-seq
MIRT1132732	hsa-miR-4436b-3p	CLIP-seq
MIRT1132733	hsa-miR-4438	CLIP-seq
MIRT1132734	hsa-miR-4447	CLIP-seq
MIRT1132735	hsa-miR-4455	CLIP-seq
MIRT1132736	hsa-miR-4472	CLIP-seq
MIRT1132737	hsa-miR-4481	CLIP-seq
MIRT1132738	hsa-miR-4533	CLIP-seq
MIRT1132739	hsa-miR-4652-5p	CLIP-seq
MIRT1132740	hsa-miR-4663	CLIP-seq
MIRT1132741	hsa-miR-4667-3p	CLIP-seq
MIRT1132742	hsa-miR-4668-3p	CLIP-seq
MIRT1132743	hsa-miR-4699-3p	CLIP-seq
MIRT1132744	hsa-miR-4710	CLIP-seq
MIRT1132745	hsa-miR-4721	CLIP-seq
MIRT1132746	hsa-miR-4728-5p	CLIP-seq
MIRT1132747	hsa-miR-4745-5p	CLIP-seq
MIRT1132748	hsa-miR-4747-5p	CLIP-seq
MIRT1132749	hsa-miR-4753-3p	CLIP-seq
MIRT1132750	hsa-miR-4758-5p	CLIP-seq
MIRT1132751	hsa-miR-4763-3p	CLIP-seq
MIRT1132752	hsa-miR-4768-5p	CLIP-seq
MIRT1132753	hsa-miR-4773	CLIP-seq
MIRT1132754	hsa-miR-4790-3p	CLIP-seq
MIRT1132755	hsa-miR-486-5p	CLIP-seq
MIRT1132756	hsa-miR-491-5p	CLIP-seq
MIRT1132757	hsa-miR-513a-3p	CLIP-seq
MIRT1132758	hsa-miR-515-5p	CLIP-seq
MIRT1132759	hsa-miR-544	CLIP-seq
MIRT1132760	hsa-miR-624	CLIP-seq
MIRT1132761	hsa-miR-628-5p	CLIP-seq
MIRT1132762	hsa-miR-657	CLIP-seq
MIRT1132763	hsa-miR-922	CLIP-seq
MIRT2037819	hsa-miR-122	CLIP-seq
MIRT1132699	hsa-miR-1252	CLIP-seq
MIRT1132700	hsa-miR-1255a	CLIP-seq
MIRT1132701	hsa-miR-1255b	CLIP-seq
MIRT2037820	hsa-miR-1470	CLIP-seq
MIRT2037821	hsa-miR-1913	CLIP-seq
MIRT2037822	hsa-miR-198	CLIP-seq
MIRT2037823	hsa-miR-214	CLIP-seq
MIRT1132704	hsa-miR-2467-3p	CLIP-seq
MIRT2037824	hsa-miR-3064-5p	CLIP-seq
MIRT1132707	hsa-miR-3121-5p	CLIP-seq
MIRT1132711	hsa-miR-3151	CLIP-seq
MIRT2037825	hsa-miR-3192	CLIP-seq
MIRT2037826	hsa-miR-324-3p	CLIP-seq
MIRT2037827	hsa-miR-361-3p	CLIP-seq
MIRT1132720	hsa-miR-3616-3p	CLIP-seq
MIRT2037828	hsa-miR-3619-5p	CLIP-seq
MIRT2037829	hsa-miR-3652	CLIP-seq
MIRT2037830	hsa-miR-3657	CLIP-seq
MIRT1132723	hsa-miR-3678-3p	CLIP-seq
MIRT2037831	hsa-miR-3922-5p	CLIP-seq
MIRT2037832	hsa-miR-4279	CLIP-seq
MIRT2037833	hsa-miR-4287	CLIP-seq
MIRT2037834	hsa-miR-4291	CLIP-seq
MIRT2037835	hsa-miR-4430	CLIP-seq
MIRT1132734	hsa-miR-4447	CLIP-seq
MIRT1132735	hsa-miR-4455	CLIP-seq
MIRT2037836	hsa-miR-4469	CLIP-seq
MIRT1132736	hsa-miR-4472	CLIP-seq
MIRT1132737	hsa-miR-4481	CLIP-seq
MIRT2037837	hsa-miR-4505	CLIP-seq
MIRT1132738	hsa-miR-4533	CLIP-seq
MIRT2037838	hsa-miR-4660	CLIP-seq
MIRT1132741	hsa-miR-4667-3p	CLIP-seq
MIRT2037839	hsa-miR-4669	CLIP-seq
MIRT2037840	hsa-miR-4685-3p	CLIP-seq
MIRT1132743	hsa-miR-4699-3p	CLIP-seq
MIRT2037841	hsa-miR-4700-3p	CLIP-seq
MIRT1132745	hsa-miR-4721	CLIP-seq
MIRT1132746	hsa-miR-4728-5p	CLIP-seq
MIRT2037842	hsa-miR-4735-5p	CLIP-seq
MIRT1132747	hsa-miR-4745-5p	CLIP-seq
MIRT2037843	hsa-miR-4749-3p	CLIP-seq
MIRT1132750	hsa-miR-4758-5p	CLIP-seq
MIRT2037844	hsa-miR-4775	CLIP-seq
MIRT2037845	hsa-miR-4795-5p	CLIP-seq
MIRT1132756	hsa-miR-491-5p	CLIP-seq
MIRT2037846	hsa-miR-513a-5p	CLIP-seq
MIRT2037847	hsa-miR-574-5p	CLIP-seq
MIRT2037848	hsa-miR-590-3p	CLIP-seq
MIRT2037849	hsa-miR-642a	CLIP-seq
MIRT2037850	hsa-miR-646	CLIP-seq
MIRT2037851	hsa-miR-7	CLIP-seq
MIRT2037852	hsa-miR-761	CLIP-seq
MIRT1132763	hsa-miR-922	CLIP-seq
MIRT2267851	hsa-miR-128	CLIP-seq
MIRT2267852	hsa-miR-18a	CLIP-seq
MIRT2267853	hsa-miR-18b	CLIP-seq
MIRT2267854	hsa-miR-2110	CLIP-seq
MIRT2267855	hsa-miR-27a	CLIP-seq
MIRT2267856	hsa-miR-27b	CLIP-seq
MIRT1132709	hsa-miR-3135b	CLIP-seq
MIRT2267857	hsa-miR-3147	CLIP-seq
MIRT2267858	hsa-miR-3150a-3p	CLIP-seq
MIRT2267859	hsa-miR-3160-3p	CLIP-seq
MIRT2267860	hsa-miR-3175	CLIP-seq
MIRT2267861	hsa-miR-3176	CLIP-seq
MIRT1132714	hsa-miR-3194-5p	CLIP-seq
MIRT2267862	hsa-miR-3689a-3p	CLIP-seq
MIRT2267863	hsa-miR-3689c	CLIP-seq
MIRT2267864	hsa-miR-3921	CLIP-seq
MIRT2267865	hsa-miR-3922-3p	CLIP-seq
MIRT2037831	hsa-miR-3922-5p	CLIP-seq
MIRT2037833	hsa-miR-4287	CLIP-seq
MIRT1132729	hsa-miR-4310	CLIP-seq
MIRT2267866	hsa-miR-4425	CLIP-seq
MIRT2267867	hsa-miR-4487	CLIP-seq
MIRT1132739	hsa-miR-4652-5p	CLIP-seq
MIRT2267868	hsa-miR-4653-5p	CLIP-seq
MIRT2037838	hsa-miR-4660	CLIP-seq
MIRT2037840	hsa-miR-4685-3p	CLIP-seq
MIRT2267869	hsa-miR-4699-5p	CLIP-seq
MIRT2267870	hsa-miR-4701-5p	CLIP-seq
MIRT1132746	hsa-miR-4728-5p	CLIP-seq
MIRT2267871	hsa-miR-4735-3p	CLIP-seq
MIRT2037845	hsa-miR-4795-5p	CLIP-seq
MIRT2267872	hsa-miR-486-3p	CLIP-seq
MIRT2267873	hsa-miR-518d-5p	CLIP-seq
MIRT2267874	hsa-miR-519b-5p	CLIP-seq
MIRT2267875	hsa-miR-519c-5p	CLIP-seq
MIRT2267876	hsa-miR-520c-5p	CLIP-seq
MIRT2267877	hsa-miR-526a	CLIP-seq
MIRT2267878	hsa-miR-558	CLIP-seq
MIRT2267879	hsa-miR-588	CLIP-seq
MIRT2267880	hsa-miR-661	CLIP-seq
MIRT2267881	hsa-miR-665	CLIP-seq
MIRT2037851	hsa-miR-7	CLIP-seq
MIRT2267882	hsa-miR-939	CLIP-seq
MIRT2453747	hsa-miR-1224-3p	CLIP-seq
MIRT2453748	hsa-miR-1260	CLIP-seq
MIRT2453749	hsa-miR-1260b	CLIP-seq
MIRT2453750	hsa-miR-1280	CLIP-seq
MIRT2453751	hsa-miR-188-3p	CLIP-seq
MIRT2453752	hsa-miR-3156-3p	CLIP-seq
MIRT2037827	hsa-miR-361-3p	CLIP-seq
MIRT2567531	hsa-miR-3925-3p	CLIP-seq
MIRT2567532	hsa-miR-4286	CLIP-seq
MIRT1132758	hsa-miR-515-5p	CLIP-seq
MIRT2567533	hsa-miR-766	CLIP-seq

Show/Hide all (62)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0000226	Process	Microtubule cytoskeleton organization	IBA
GO:0000226	Process	Microtubule cytoskeleton organization	IDA	34782749
GO:0000226	Process	Microtubule cytoskeleton organization	IMP	23400999
GO:0000226	Process	Microtubule cytoskeleton organization	IMP	14594945
GO:0000930	Component	Gamma-tubulin complex	IDA	25123532
GO:0001578	Process	Microtubule bundle formation	IEP	14594945
GO:0004672	Function	Protein kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	IDA
GO:0004674	Function	Protein serine/threonine kinase activity	IEA
GO:0004674	Function	Protein serine/threonine kinase activity	NAS	28386764
GO:0005515	Function	Protein binding	IPI	14594945, 14676191, 16959763, 23666762, 25416956, 32814053, 36931259
GO:0005524	Function	ATP binding	IEA
GO:0005524	Function	ATP binding	NAS
GO:0005737	Component	Cytoplasm	IBA
GO:0005737	Component	Cytoplasm	IDA	23666762
GO:0005737	Component	Cytoplasm	IEA
GO:0005813	Component	Centrosome	IDA	14594945, 25123532
GO:0005813	Component	Centrosome	IEA
GO:0005815	Component	Microtubule organizing center	IDA	28656979
GO:0005815	Component	Microtubule organizing center	IDA	14594945
GO:0005815	Component	Microtubule organizing center	IEA
GO:0005815	Component	Microtubule organizing center	IEA
GO:0005829	Component	Cytosol	IDA
GO:0005829	Component	Cytosol	TAS
GO:0005856	Component	Cytoskeleton	IEA
GO:0006468	Process	Protein phosphorylation	IMP	23666762
GO:0006468	Process	Protein phosphorylation	TAS	14594945
GO:0007399	Process	Nervous system development	IDA	14594945
GO:0008017	Function	Microtubule binding	IDA	14594945
GO:0008093	Function	Cytoskeletal anchor activity	IDA	28656979
GO:0008093	Function	Cytoskeletal anchor activity	IEA
GO:0015630	Component	Microtubule cytoskeleton	IDA	14594945
GO:0016301	Function	Kinase activity	IEA
GO:0016740	Function	Transferase activity	IEA
GO:0030030	Process	Cell projection organization	IEA
GO:0030425	Component	Dendrite	IDA	23666762
GO:0030425	Component	Dendrite	IEA
GO:0030496	Component	Midbody	IDA	25123532
GO:0035556	Process	Intracellular signal transduction	IBA
GO:0036064	Component	Ciliary basal body	IMP	23400999
GO:0042995	Component	Cell projection	IEA
GO:0043005	Component	Neuron projection	IDA	14594945
GO:0043015	Function	Gamma-tubulin binding	IDA	14594945
GO:0043068	Process	Positive regulation of programmed cell death	NAS
GO:0043130	Function	Ubiquitin binding	NAS	14594945
GO:0044782	Process	Cilium organization	IGI	23400999
GO:0045724	Process	Positive regulation of cilium assembly	IMP	23400999
GO:0045787	Process	Positive regulation of cell cycle	IDA	26882547
GO:0046605	Process	Regulation of centrosome cycle	IMP	25123532
GO:0046785	Process	Microtubule polymerization	IDA	10791892, 34782749
GO:0048156	Function	Tau protein binding	NAS	28386764
GO:0050321	Function	Tau-protein kinase activity	IBA
GO:0050321	Function	Tau-protein kinase activity	IDA	14594945
GO:0050321	Function	Tau-protein kinase activity	IMP	23666762, 27708431
GO:0050321	Function	Tau-protein kinase activity	NAS	28386764
GO:0051301	Process	Cell division	IEA
GO:0061523	Process	Cilium disassembly	IDA	34782749
GO:0106310	Function	Protein serine kinase activity	IEA
GO:1900227	Process	Positive regulation of NLRP3 inflammasome complex assembly	IDA	28656979
GO:1900227	Process	Positive regulation of NLRP3 inflammasome complex assembly	IEA
GO:1904781	Process	Positive regulation of protein localization to centrosome	IMP	23400999

MIM	HGNC	e!Ensembl
606495	13538	ENSG00000007047

Q96L34

Protein name

MAP/microtubule affinity-regulating kinase 4 (EC 2.7.11.1) (MAP/microtubule affinity-regulating kinase-like 1)

Protein function

Serine/threonine-protein kinase (PubMed:14594945, PubMed:15009667, PubMed:23184942, PubMed:23666762). Phosphorylates the microtubule-associated protein MAPT/TAU (PubMed:14594945, PubMed:23666762). Also phosphorylates the microtubule-associated p

PDB

5ES1 , 8XFL

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00069	Pkinase	59 → 310	Protein kinase domain	Domain
PF00627	UBA	331 → 366	UBA/TS-N domain	Domain
PF02149	KA1	710 → 752	Kinase associated domain 1	Domain

Tissue specificity

TISSUE SPECIFICITY: Ubiquitous. Isoform 2 is brain-specific (PubMed:11326310). Expressed at highest levels in brain and testis. Also expressed in heart, lung, liver, muscle, kidney and spleen (PubMed:14594945). {ECO:0000269|PubMed:11326310, ECO:0000269|Pu

Sequence

MSSRTVLAPGNDRNSDTHGTLGSGRSSDKGPSWSSRSLGARCRNSIASCPEEQPHVGNYR
LLRTIGKGNFAKVKLARHILTGREVAIKIIDKTQLNPSSLQKLFREVRIMKGLNHPNIVK
LFEVIETEKTLYLVMEYASAGEVFDYLVSHGRMKEKEARAKFRQIVSAVHYCHQKNIVHR
DLKAENLLLDAEANIKIADFGFSNEFTLGSKLDTFCGSPPYAAPELFQGKKYDGPEVDIW
SLGVILYTLVSGSLPFDGHNLKELRERVLRGKYRVPFYMSTDCESILRRFLVLNPAKRCT
LEQIMKDKWINIGYEGEELKPYTEPEEDFGDTKRIEVMVGMGYTREEIKESLTSQKYNEV
TATYLLLGRKTEEGGDRGAPGLALARVRAPSDTTNGTSSSKGTSHSKGQRSSSSTYHRQR
RHSDFCGPSPAPLHPKRSPTSTGEAELKEERLPGRKASCSTAGSGSRGLPPSSPMVSSAH
NPNKAEIPERRKDSTSTPNNLPPSMMTRRNTYVCTERPGAERPSLLPNGKENSSGTPRVP
PASPSSHSLAPPSGERSRLARGSTIRSTFHGGQVRDRRAGGGGGGGVQNGPPASPTLAHE
AAPLPAGRPRPTTNLFTKLTSKLTRRVADEPERIGGPEVTSCHLPWDQTETAPRLLRFPW
SVKLTSSRPPEALMAALRQATAAARCRCRQPQPFLLACLHGGAGGPEPLSHFEVEVCQLP
RPGLRGVLFRRVAGTALAFRTLVTRISNDLEL

Sequence length

752

Interactions

View interactions

	Reactome
			Anchoring of the basal body to the plasma membrane

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (14)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ALZHEIMER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATROPHIC MACULAR DEGENERATION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GASTROESOPHAGEAL REFLUX DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hepatocellular carcinoma	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPEROPIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MYOCARDIAL INFARCTION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEURODEVELOPMENTAL DISORDER	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEURODEVELOPMENTAL DISORDERS	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PEPTIC ULCER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCOLIOSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
WET MACULAR DEGENERATION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (52)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Adenocarcinoma of large intestine	Colorectal Cancer	UNIPROT_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Age related macular degeneration	Age-related macular degeneration	GWASCAT_DG	26691988		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer Disease	Alzheimer disease	Pubtator	21811019, 24533944, 28554490	Associate	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Alzheimer Disease, Late Onset	Alzheimer disease	BEFREE	21321396, 22381399		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer`s Disease	Alzheimer disease	GWASDB_DG	21379329, 21460841, 22832961, 23565137, 24755620		★★★★★ ★☆☆☆☆ Found in Text Mining only
Alzheimer`s Disease	Alzheimer disease	GWASCAT_DG	29777097, 30617256		★★★★★ ★☆☆☆☆ Found in Text Mining only
Anhydramnios	Anhydramnios	CLINVAR_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Arteriosclerosis	Arteriosclerosis	BEFREE	31167564		★★★★★ ★☆☆☆☆ Found in Text Mining only
Atherosclerosis	Atherosclerosis	BEFREE	31167564		★★★★★ ★☆☆☆☆ Found in Text Mining only
Brain Neoplasms	Brain Neoplasms	BEFREE	25578778		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	22506312, 28183853		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	11326310	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of lung	Lung carcinoma	BEFREE	26882547		★★★★★ ★☆☆☆☆ Found in Text Mining only
Cerebrovascular accident	Stroke	BEFREE	31429800		★★★★★ ★☆☆☆☆ Found in Text Mining only
Congenital Abnormalities	Congenital abnormalities	Pubtator	38041405	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Coronary Artery Disease	Coronary artery disease	GWASCAT_DG	29212778		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Dandy-Walker Syndrome	Dandy-Walker Syndrome	CLINVAR_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Developmental Disabilities	Developmental disability	Pubtator	38041405	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes	Diabetes	BEFREE	29683402		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus	Diabetes Mellitus	BEFREE	29683402		★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	27748164		★★★★★ ★☆☆☆☆ Found in Text Mining only
Exudative age-related macular degeneration	Exudative Macular Degeneration	GWASCAT_DG	26691988		★★★★★ ★☆☆☆☆ Found in Text Mining only
exudative macular degeneration	Exudative macular degeneration	GWASCAT_DG	26691988		★★★★★ ★☆☆☆☆ Found in Text Mining only
Geographic Atrophy	Geographic Atrophy	GWASCAT_DG	26691988		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	BEFREE	12735302		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma	Glioblastoma	Pubtator	19759416	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioblastoma Multiforme	Glioblastoma	BEFREE	12735302		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	LHGDN	12735302		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	19759416	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	BEFREE	22156016, 25578778		★★★★★ ★☆☆☆☆ Found in Text Mining only
Hermanski-Pudlak Syndrome	Hermansky-Pudlak Syndrome	CLINVAR_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
HERMANSKY-PUDLAK SYNDROME 8	Hermansky-Pudlak Syndrome	CLINVAR_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Hyperlipidemia	Hyperlipidemia	BEFREE	31322078		★★★★★ ★☆☆☆☆ Found in Text Mining only
Intellectual Disability	Intellectual developmental disorder	Pubtator	38041405	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Learning Disabilities	Learning disorders	Pubtator	38041405	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	31179271		★★★★★ ★☆☆☆☆ Found in Text Mining only
Macular Degeneration	Macular degeneration	Pubtator	33618707	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	22506312, 28183853		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of lung	Lung Cancer	BEFREE	26882547		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	25578778, 26882547, 27748164, 28842631, 29079437, 29683402, 30290280		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	22506312		★★★★★ ★☆☆☆☆ Found in Text Mining only
Meckel-Gruber syndrome	Meckel-Gruber Syndrome	CLINVAR_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Metabolic Syndrome X	Metabolic Syndrome	BEFREE	31322078		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	22156016		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neurodegenerative Disorders	Neurodegenerative Disorders	BEFREE	28842631, 29683402, 31512980		★★★★★ ★☆☆☆☆ Found in Text Mining only
Obesity	Obesity	BEFREE	30857324		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian Neoplasms	Ovarian neoplasm	Pubtator	28122348	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Peutz-Jeghers Syndrome	Peutz-Jeghers Syndrome	BEFREE	17924967		★★★★★ ★☆☆☆☆ Found in Text Mining only
Polycystic Kidney Diseases	Polycystic kidney disease	CLINVAR_DG			★★★★★ ★☆☆☆☆ Found in Text Mining only
Stomach Neoplasms	Stomach neoplasms	Pubtator	34037089	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Tauopathies	Tauopathies	BEFREE	27708431		★★★★★ ★☆☆☆☆ Found in Text Mining only
Trichohepatoenteric Syndrome	Trichohepatoenteric Syndrome	BEFREE	31322078		★★★★★ ★☆☆☆☆ Found in Text Mining only

MARK4 (microtubule affinity regulating kinase 4)