Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	57732
Gene name	Zinc finger FYVE-type containing 28
Gene symbol	ZFYVE28
Synonyms (NCBI Gene)	LST2LYST2lst-2
Chromosome	4
Chromosome location	4p16.3

Show/Hide all (83)

miRTarBase ID	miRNA	Experiments	Reference
MIRT018096	hsa-miR-335-5p	Microarray	18185580
MIRT026573	hsa-miR-192-5p	Microarray	19074876
MIRT1512734	hsa-miR-3145-5p	CLIP-seq
MIRT1512735	hsa-miR-4286	CLIP-seq
MIRT1512736	hsa-miR-1321	CLIP-seq
MIRT1512737	hsa-miR-214	CLIP-seq
MIRT1512738	hsa-miR-3120-3p	CLIP-seq
MIRT1512739	hsa-miR-3125	CLIP-seq
MIRT1512740	hsa-miR-3148	CLIP-seq
MIRT1512741	hsa-miR-34a	CLIP-seq
MIRT1512742	hsa-miR-34c-5p	CLIP-seq
MIRT1512743	hsa-miR-3619-5p	CLIP-seq
MIRT1512744	hsa-miR-3688-3p	CLIP-seq
MIRT1512745	hsa-miR-3688-5p	CLIP-seq
MIRT1512746	hsa-miR-3916	CLIP-seq
MIRT1512747	hsa-miR-4264	CLIP-seq
MIRT1512748	hsa-miR-4270	CLIP-seq
MIRT1512749	hsa-miR-4302	CLIP-seq
MIRT1512750	hsa-miR-4419a	CLIP-seq
MIRT1512751	hsa-miR-4434	CLIP-seq
MIRT1512752	hsa-miR-4441	CLIP-seq
MIRT1512753	hsa-miR-449a	CLIP-seq
MIRT1512754	hsa-miR-449b	CLIP-seq
MIRT1512755	hsa-miR-4510	CLIP-seq
MIRT1512756	hsa-miR-4516	CLIP-seq
MIRT1512757	hsa-miR-4531	CLIP-seq
MIRT1512758	hsa-miR-4706	CLIP-seq
MIRT1512759	hsa-miR-4723-5p	CLIP-seq
MIRT1512760	hsa-miR-4728-5p	CLIP-seq
MIRT1512761	hsa-miR-4739	CLIP-seq
MIRT1512762	hsa-miR-4749-5p	CLIP-seq
MIRT1512763	hsa-miR-4756-5p	CLIP-seq
MIRT1512764	hsa-miR-4779	CLIP-seq
MIRT1512765	hsa-miR-4797-3p	CLIP-seq
MIRT1512766	hsa-miR-4802-3p	CLIP-seq
MIRT1512767	hsa-miR-644	CLIP-seq
MIRT1512768	hsa-miR-744	CLIP-seq
MIRT1512769	hsa-miR-761	CLIP-seq
MIRT1512770	hsa-miR-802	CLIP-seq
MIRT1512771	hsa-miR-877	CLIP-seq
MIRT1512772	hsa-miR-1286	CLIP-seq
MIRT1512773	hsa-miR-2467-5p	CLIP-seq
MIRT1512774	hsa-miR-4436a	CLIP-seq
MIRT1512775	hsa-miR-4782-5p	CLIP-seq
MIRT1512776	hsa-miR-760	CLIP-seq
MIRT1921112	hsa-miR-4760-5p	CLIP-seq
MIRT1921842	hsa-miR-2116	CLIP-seq
MIRT1921843	hsa-miR-4677-5p	CLIP-seq
MIRT1921842	hsa-miR-2116	CLIP-seq
MIRT1923078	hsa-miR-375	CLIP-seq
MIRT1923079	hsa-miR-4273	CLIP-seq
MIRT1921843	hsa-miR-4677-5p	CLIP-seq
MIRT2154472	hsa-miR-2467-3p	CLIP-seq
MIRT2154473	hsa-miR-30a	CLIP-seq
MIRT2154474	hsa-miR-30b	CLIP-seq
MIRT2154475	hsa-miR-30c	CLIP-seq
MIRT2154476	hsa-miR-30d	CLIP-seq
MIRT2154477	hsa-miR-30e	CLIP-seq
MIRT1512734	hsa-miR-3145-5p	CLIP-seq
MIRT2154478	hsa-miR-3179	CLIP-seq
MIRT2154479	hsa-miR-3202	CLIP-seq
MIRT2154480	hsa-miR-3678-3p	CLIP-seq
MIRT2154481	hsa-miR-4271	CLIP-seq
MIRT2154482	hsa-miR-4725-3p	CLIP-seq
MIRT2154483	hsa-miR-4747-5p	CLIP-seq
MIRT2154484	hsa-miR-4795-5p	CLIP-seq
MIRT2154485	hsa-miR-508-5p	CLIP-seq
MIRT2374645	hsa-miR-1184	CLIP-seq
MIRT2154473	hsa-miR-30a	CLIP-seq
MIRT2154474	hsa-miR-30b	CLIP-seq
MIRT2154475	hsa-miR-30c	CLIP-seq
MIRT2154476	hsa-miR-30d	CLIP-seq
MIRT2154477	hsa-miR-30e	CLIP-seq
MIRT1512734	hsa-miR-3145-5p	CLIP-seq
MIRT2374646	hsa-miR-448	CLIP-seq
MIRT2374647	hsa-miR-4749-3p	CLIP-seq
MIRT2154485	hsa-miR-508-5p	CLIP-seq
MIRT2374648	hsa-miR-586	CLIP-seq
MIRT2154472	hsa-miR-2467-3p	CLIP-seq
MIRT1512738	hsa-miR-3120-3p	CLIP-seq
MIRT2667262	hsa-miR-3671	CLIP-seq
MIRT2667263	hsa-miR-4310	CLIP-seq
MIRT2667264	hsa-miR-607	CLIP-seq

Show/Hide all (15)

GO ID	Ontology	Definition	Evidence	Reference
GO:0005515	Function	Protein binding	IPI	19460345
GO:0005737	Component	Cytoplasm	IEA
GO:0005768	Component	Endosome	IEA
GO:0005829	Component	Cytosol	IDA	19460345
GO:0005829	Component	Cytosol	IEA
GO:0007175	Process	Negative regulation of epidermal growth factor-activated receptor activity	IMP	19460345
GO:0008270	Function	Zinc ion binding	IEA
GO:0016020	Component	Membrane	IEA
GO:0031901	Component	Early endosome membrane	IBA
GO:0031901	Component	Early endosome membrane	IDA	19460345
GO:0031901	Component	Early endosome membrane	IEA
GO:0032266	Function	Phosphatidylinositol-3-phosphate binding	IDA	19460345
GO:0042059	Process	Negative regulation of epidermal growth factor receptor signaling pathway	IBA
GO:0042059	Process	Negative regulation of epidermal growth factor receptor signaling pathway	IMP	19460345
GO:0046872	Function	Metal ion binding	IEA

MIM	HGNC	e!Ensembl
614176	29334	ENSG00000159733

Q9HCC9

Protein name

Lateral signaling target protein 2 homolog (hLst2) (Zinc finger FYVE domain-containing protein 28)

Protein function

Negative regulator of epidermal growth factor receptor (EGFR) signaling. Acts by promoting EGFR degradation in endosomes when not monoubiquitinated.

PDB

9F42 , 9F43 , 9F44 , 9F45

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF01363	FYVE	812 → 876	FYVE zinc finger	Domain

Sequence

MMNRFRKWLYKPKRSDPQLLARFYYADEELNQVAAELDSLDGRKDPQRCTLLVSQFRSCQ
DNVLNIINQIMDECIPQDRAPRDFCVKFPEEIRHDNLAGQLWFGAECLAAGSIIMNRELE
SMAMRPLAKELTRSLEDVRGALRDQALRDLNTYTEKMREALRHFDVLFAEFELSYVSAMV
PVKSPREYYVQQEVIVLFCETVERALDFGYLTQDMIDDYEPALMFSIPRLAIVCGLVVYA
DGPLNLDRKVEDMSELFRPFHTLLRKIRDLLQTLTEEELHTLERNLCISQDVEFPIRADV
QGPAALAPALSAPLPPEGPLSAKAKDPDAELACSMQYDDQELEQLSRMVHRAGDEMSSLL
SPPIACQSPAHRPGAEGSPGGEASPGRPRLRSGSDEEERVFFMDDVEGTAEALARPESPA
GPFGWAGSTWADPQEKGQGGPGGAAGISLPASEKEEDLSNNNLEAEGTDGASLAGTSSCS
CLDSRLHLDGWEVGADDAETAEMIAHRTGGMKLSATVIFNPKSPTSLDSAVATQEAASEP
VAEGMDGGPHKLSTGATNCLLHSCVCCGSCGDSREDVVERLREKCSPGGVIGASYAAGLA
KASDRAPERQEEAPPPSEDASNGREPKAPTSDKCLPHTSGSQVDTASGLQGEAGVAGQQE
PEARELHAGSPSAHEAPQALSGSSSSTAGSCSSDKMGPEAAPAATHAAPQATREKIRSRF
HGSHDLIHRLFVCISGVADQLQTNYASDLRSILKTLFEVMATKPETDDKEKLRKVTQTLR
SAALEDCALCQETLSSSELAAKTRDGDFEDPPEWVPDEACGFCTACKAPFTVIRRKHHCR
SCGKIFCSRCSSHSAPLPRYGQVKPVRVCTHCYMFHVTPFYSDKAGL

Sequence length

887

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (8)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ALZHEIMER DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CERVICAL CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CERVICAL CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GASTROINTESTINAL DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Sarcoma	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Thyroid cancer, nonmedullary, 1	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (1)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Malignant neoplasm of gastrointestinal tract	Malignant gastrointestinal tract tumors	BEFREE	18648741		★★★★★ ★☆☆☆☆ Found in Text Mining only

ZFYVE28 (zinc finger FYVE-type containing 28)