Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	57727
Gene name	Nuclear receptor coactivator 5
Gene symbol	NCOA5
Synonyms (NCBI Gene)	CIAbA465L10.6
Chromosome	20
Chromosome location	20q13.12
Summary	This gene encodes a coregulator for the alpha and beta estrogen receptors and the orphan nuclear receptor NR1D2. The protein localizes to the nucleus, and is thought to have both coactivator and corepressor functions. Its interaction with nuclear receptor

266

Show/Hide all (266)

miRTarBase ID	miRNA	Experiments	Reference
MIRT051979	hsa-let-7b-5p	CLASH	23622248
MIRT499974	hsa-miR-6813-3p	PAR-CLIP	24398324
MIRT499973	hsa-miR-3919	PAR-CLIP	24398324
MIRT499972	hsa-miR-4756-3p	PAR-CLIP	24398324
MIRT499971	hsa-miR-212-5p	PAR-CLIP	24398324
MIRT499969	hsa-miR-4284	PAR-CLIP	24398324
MIRT499970	hsa-miR-24-3p	PAR-CLIP	24398324
MIRT499968	hsa-miR-8057	PAR-CLIP	24398324
MIRT499974	hsa-miR-6813-3p	PAR-CLIP	24398324
MIRT499973	hsa-miR-3919	PAR-CLIP	24398324
MIRT499972	hsa-miR-4756-3p	PAR-CLIP	24398324
MIRT499971	hsa-miR-212-5p	PAR-CLIP	24398324
MIRT499969	hsa-miR-4284	PAR-CLIP	24398324
MIRT499970	hsa-miR-24-3p	PAR-CLIP	24398324
MIRT499968	hsa-miR-8057	PAR-CLIP	24398324
MIRT1177312	hsa-miR-1272	CLIP-seq
MIRT1177313	hsa-miR-1322	CLIP-seq
MIRT1177314	hsa-miR-140-3p	CLIP-seq
MIRT1177315	hsa-miR-335	CLIP-seq
MIRT1177316	hsa-miR-342-5p	CLIP-seq
MIRT1177317	hsa-miR-3663-3p	CLIP-seq
MIRT1177318	hsa-miR-3675-5p	CLIP-seq
MIRT1177319	hsa-miR-3689a-3p	CLIP-seq
MIRT1177320	hsa-miR-3689c	CLIP-seq
MIRT1177321	hsa-miR-4305	CLIP-seq
MIRT1177322	hsa-miR-4651	CLIP-seq
MIRT1177323	hsa-miR-4664-5p	CLIP-seq
MIRT1177324	hsa-miR-4695-5p	CLIP-seq
MIRT1177325	hsa-miR-4710	CLIP-seq
MIRT1177326	hsa-miR-4728-5p	CLIP-seq
MIRT1177327	hsa-miR-4773	CLIP-seq
MIRT1177328	hsa-miR-608	CLIP-seq
MIRT1177329	hsa-miR-640	CLIP-seq
MIRT1177330	hsa-miR-759	CLIP-seq
MIRT1177331	hsa-miR-765	CLIP-seq
MIRT2051303	hsa-miR-1234	CLIP-seq
MIRT2051304	hsa-miR-1255a	CLIP-seq
MIRT2051305	hsa-miR-1255b	CLIP-seq
MIRT2051306	hsa-miR-3117-5p	CLIP-seq
MIRT2051307	hsa-miR-3150a-3p	CLIP-seq
MIRT2051308	hsa-miR-3184	CLIP-seq
MIRT2051309	hsa-miR-3192	CLIP-seq
MIRT2051310	hsa-miR-3199	CLIP-seq
MIRT1177319	hsa-miR-3689a-3p	CLIP-seq
MIRT1177320	hsa-miR-3689c	CLIP-seq
MIRT2051311	hsa-miR-3925-5p	CLIP-seq
MIRT2051312	hsa-miR-3973	CLIP-seq
MIRT2051313	hsa-miR-423-5p	CLIP-seq
MIRT2051314	hsa-miR-425	CLIP-seq
MIRT2051315	hsa-miR-4300	CLIP-seq
MIRT2051316	hsa-miR-4515	CLIP-seq
MIRT2051317	hsa-miR-4652-5p	CLIP-seq
MIRT2051318	hsa-miR-4691-5p	CLIP-seq
MIRT1177324	hsa-miR-4695-5p	CLIP-seq
MIRT1177326	hsa-miR-4728-5p	CLIP-seq
MIRT1177327	hsa-miR-4773	CLIP-seq
MIRT2051319	hsa-miR-4796-3p	CLIP-seq
MIRT2051320	hsa-miR-520g	CLIP-seq
MIRT2051321	hsa-miR-520h	CLIP-seq
MIRT2051322	hsa-miR-628-5p	CLIP-seq
MIRT2051323	hsa-miR-661	CLIP-seq
MIRT1177330	hsa-miR-759	CLIP-seq
MIRT1177331	hsa-miR-765	CLIP-seq
MIRT2051324	hsa-miR-920	CLIP-seq
MIRT2280381	hsa-miR-1207-3p	CLIP-seq
MIRT2280382	hsa-miR-1207-5p	CLIP-seq
MIRT2051303	hsa-miR-1234	CLIP-seq
MIRT2051304	hsa-miR-1255a	CLIP-seq
MIRT2051305	hsa-miR-1255b	CLIP-seq
MIRT2280383	hsa-miR-149	CLIP-seq
MIRT2280384	hsa-miR-2278	CLIP-seq
MIRT2280385	hsa-miR-2861	CLIP-seq
MIRT2280386	hsa-miR-298	CLIP-seq
MIRT2280387	hsa-miR-3065-5p	CLIP-seq
MIRT2051306	hsa-miR-3117-5p	CLIP-seq
MIRT2280388	hsa-miR-3125	CLIP-seq
MIRT2051307	hsa-miR-3150a-3p	CLIP-seq
MIRT2280389	hsa-miR-3175	CLIP-seq
MIRT2051308	hsa-miR-3184	CLIP-seq
MIRT2280390	hsa-miR-3187-3p	CLIP-seq
MIRT2280391	hsa-miR-3189-3p	CLIP-seq
MIRT2051309	hsa-miR-3192	CLIP-seq
MIRT2051310	hsa-miR-3199	CLIP-seq
MIRT2280392	hsa-miR-3529	CLIP-seq
MIRT2280393	hsa-miR-3665	CLIP-seq
MIRT1177319	hsa-miR-3689a-3p	CLIP-seq
MIRT1177320	hsa-miR-3689c	CLIP-seq
MIRT2280394	hsa-miR-379	CLIP-seq
MIRT2280395	hsa-miR-3916	CLIP-seq
MIRT2051311	hsa-miR-3925-5p	CLIP-seq
MIRT2280396	hsa-miR-410	CLIP-seq
MIRT2051313	hsa-miR-423-5p	CLIP-seq
MIRT2051315	hsa-miR-4300	CLIP-seq
MIRT2280397	hsa-miR-4451	CLIP-seq
MIRT2051316	hsa-miR-4515	CLIP-seq
MIRT2280398	hsa-miR-4529-5p	CLIP-seq
MIRT2280399	hsa-miR-4536	CLIP-seq
MIRT2280400	hsa-miR-4650-3p	CLIP-seq
MIRT2051317	hsa-miR-4652-5p	CLIP-seq
MIRT2280401	hsa-miR-4667-5p	CLIP-seq
MIRT2280402	hsa-miR-4691-3p	CLIP-seq
MIRT2051318	hsa-miR-4691-5p	CLIP-seq
MIRT1177324	hsa-miR-4695-5p	CLIP-seq
MIRT2280403	hsa-miR-4700-5p	CLIP-seq
MIRT1177326	hsa-miR-4728-5p	CLIP-seq
MIRT2280404	hsa-miR-4731-3p	CLIP-seq
MIRT2280405	hsa-miR-4736	CLIP-seq
MIRT2280406	hsa-miR-4763-3p	CLIP-seq
MIRT2280407	hsa-miR-4769-3p	CLIP-seq
MIRT2280408	hsa-miR-4801	CLIP-seq
MIRT2280409	hsa-miR-4803	CLIP-seq
MIRT2280410	hsa-miR-4804-3p	CLIP-seq
MIRT2280411	hsa-miR-512-5p	CLIP-seq
MIRT2280412	hsa-miR-548aa	CLIP-seq
MIRT2280413	hsa-miR-583	CLIP-seq
MIRT2280414	hsa-miR-635	CLIP-seq
MIRT2280415	hsa-miR-639	CLIP-seq
MIRT2051323	hsa-miR-661	CLIP-seq
MIRT1177331	hsa-miR-765	CLIP-seq
MIRT2051324	hsa-miR-920	CLIP-seq
MIRT2280416	hsa-miR-939	CLIP-seq
MIRT2578827	hsa-miR-105	CLIP-seq
MIRT2051303	hsa-miR-1234	CLIP-seq
MIRT2578828	hsa-miR-1270	CLIP-seq
MIRT2578829	hsa-miR-128	CLIP-seq
MIRT2280383	hsa-miR-149	CLIP-seq
MIRT2578830	hsa-miR-1910	CLIP-seq
MIRT2578831	hsa-miR-1976	CLIP-seq
MIRT2578832	hsa-miR-2052	CLIP-seq
MIRT2578833	hsa-miR-2682	CLIP-seq
MIRT2578834	hsa-miR-27a	CLIP-seq
MIRT2578835	hsa-miR-27b	CLIP-seq
MIRT2578836	hsa-miR-28-5p	CLIP-seq
MIRT2280385	hsa-miR-2861	CLIP-seq
MIRT2051306	hsa-miR-3117-5p	CLIP-seq
MIRT2578837	hsa-miR-3139	CLIP-seq
MIRT2578838	hsa-miR-3140-3p	CLIP-seq
MIRT2578839	hsa-miR-3151	CLIP-seq
MIRT2578840	hsa-miR-3162-3p	CLIP-seq
MIRT2578841	hsa-miR-3170	CLIP-seq
MIRT2051309	hsa-miR-3192	CLIP-seq
MIRT1177315	hsa-miR-335	CLIP-seq
MIRT2578842	hsa-miR-34b	CLIP-seq
MIRT2578843	hsa-miR-3545-5p	CLIP-seq
MIRT2578844	hsa-miR-3663-5p	CLIP-seq
MIRT2578845	hsa-miR-3664-3p	CLIP-seq
MIRT2578846	hsa-miR-3670	CLIP-seq
MIRT1177319	hsa-miR-3689a-3p	CLIP-seq
MIRT1177320	hsa-miR-3689c	CLIP-seq
MIRT2578847	hsa-miR-370	CLIP-seq
MIRT2578848	hsa-miR-3913-3p	CLIP-seq
MIRT2578849	hsa-miR-3922-5p	CLIP-seq
MIRT2051311	hsa-miR-3925-5p	CLIP-seq
MIRT2051312	hsa-miR-3973	CLIP-seq
MIRT2578850	hsa-miR-4261	CLIP-seq
MIRT2578851	hsa-miR-4281	CLIP-seq
MIRT2051315	hsa-miR-4300	CLIP-seq
MIRT1177321	hsa-miR-4305	CLIP-seq
MIRT2578852	hsa-miR-4420	CLIP-seq
MIRT2578853	hsa-miR-4433	CLIP-seq
MIRT2578854	hsa-miR-4480	CLIP-seq
MIRT2578855	hsa-miR-4496	CLIP-seq
MIRT2578856	hsa-miR-449c	CLIP-seq
MIRT2578857	hsa-miR-4514	CLIP-seq
MIRT2578858	hsa-miR-4531	CLIP-seq
MIRT2280399	hsa-miR-4536	CLIP-seq
MIRT2578859	hsa-miR-455-3p	CLIP-seq
MIRT2578860	hsa-miR-4633-3p	CLIP-seq
MIRT2578861	hsa-miR-4659a-3p	CLIP-seq
MIRT2578862	hsa-miR-4659b-3p	CLIP-seq
MIRT2578863	hsa-miR-4683	CLIP-seq
MIRT2051318	hsa-miR-4691-5p	CLIP-seq
MIRT2578864	hsa-miR-4692	CLIP-seq
MIRT1177324	hsa-miR-4695-5p	CLIP-seq
MIRT2578865	hsa-miR-4712-5p	CLIP-seq
MIRT2578866	hsa-miR-4722-3p	CLIP-seq
MIRT2578867	hsa-miR-4722-5p	CLIP-seq
MIRT1177326	hsa-miR-4728-5p	CLIP-seq
MIRT2578868	hsa-miR-4753-5p	CLIP-seq
MIRT2578869	hsa-miR-4763-5p	CLIP-seq
MIRT1177327	hsa-miR-4773	CLIP-seq
MIRT2051319	hsa-miR-4796-3p	CLIP-seq
MIRT2578870	hsa-miR-489	CLIP-seq
MIRT2578871	hsa-miR-513a-5p	CLIP-seq
MIRT2051320	hsa-miR-520g	CLIP-seq
MIRT2051321	hsa-miR-520h	CLIP-seq
MIRT2578872	hsa-miR-541	CLIP-seq
MIRT2578873	hsa-miR-550a	CLIP-seq
MIRT2578874	hsa-miR-582-3p	CLIP-seq
MIRT2578875	hsa-miR-618	CLIP-seq
MIRT2578876	hsa-miR-620	CLIP-seq
MIRT2051322	hsa-miR-628-5p	CLIP-seq
MIRT2578877	hsa-miR-645	CLIP-seq
MIRT2578878	hsa-miR-654-5p	CLIP-seq
MIRT2051323	hsa-miR-661	CLIP-seq
MIRT2578879	hsa-miR-708	CLIP-seq
MIRT1177331	hsa-miR-765	CLIP-seq
MIRT2578880	hsa-miR-767-3p	CLIP-seq
MIRT2578881	hsa-miR-770-5p	CLIP-seq
MIRT2578882	hsa-miR-873	CLIP-seq
MIRT2051324	hsa-miR-920	CLIP-seq
MIRT2578883	hsa-miR-936	CLIP-seq
MIRT2578884	hsa-miR-940	CLIP-seq
MIRT2578827	hsa-miR-105	CLIP-seq
MIRT2578829	hsa-miR-128	CLIP-seq
MIRT2280383	hsa-miR-149	CLIP-seq
MIRT2578830	hsa-miR-1910	CLIP-seq
MIRT2578831	hsa-miR-1976	CLIP-seq
MIRT2578833	hsa-miR-2682	CLIP-seq
MIRT2578834	hsa-miR-27a	CLIP-seq
MIRT2578835	hsa-miR-27b	CLIP-seq
MIRT2578836	hsa-miR-28-5p	CLIP-seq
MIRT2280385	hsa-miR-2861	CLIP-seq
MIRT2051306	hsa-miR-3117-5p	CLIP-seq
MIRT2578837	hsa-miR-3139	CLIP-seq
MIRT2578838	hsa-miR-3140-3p	CLIP-seq
MIRT2578839	hsa-miR-3151	CLIP-seq
MIRT2578840	hsa-miR-3162-3p	CLIP-seq
MIRT2578841	hsa-miR-3170	CLIP-seq
MIRT1177315	hsa-miR-335	CLIP-seq
MIRT2578843	hsa-miR-3545-5p	CLIP-seq
MIRT2578844	hsa-miR-3663-5p	CLIP-seq
MIRT2578845	hsa-miR-3664-3p	CLIP-seq
MIRT2578846	hsa-miR-3670	CLIP-seq
MIRT2578847	hsa-miR-370	CLIP-seq
MIRT2578848	hsa-miR-3913-3p	CLIP-seq
MIRT2578849	hsa-miR-3922-5p	CLIP-seq
MIRT2051312	hsa-miR-3973	CLIP-seq
MIRT2578850	hsa-miR-4261	CLIP-seq
MIRT2578851	hsa-miR-4281	CLIP-seq
MIRT1177321	hsa-miR-4305	CLIP-seq
MIRT2578853	hsa-miR-4433	CLIP-seq
MIRT2578854	hsa-miR-4480	CLIP-seq
MIRT2578855	hsa-miR-4496	CLIP-seq
MIRT2578856	hsa-miR-449c	CLIP-seq
MIRT2578857	hsa-miR-4514	CLIP-seq
MIRT2280399	hsa-miR-4536	CLIP-seq
MIRT2578859	hsa-miR-455-3p	CLIP-seq
MIRT2578860	hsa-miR-4633-3p	CLIP-seq
MIRT2578861	hsa-miR-4659a-3p	CLIP-seq
MIRT2578862	hsa-miR-4659b-3p	CLIP-seq
MIRT2578864	hsa-miR-4692	CLIP-seq
MIRT2578865	hsa-miR-4712-5p	CLIP-seq
MIRT2578866	hsa-miR-4722-3p	CLIP-seq
MIRT2578867	hsa-miR-4722-5p	CLIP-seq
MIRT2578868	hsa-miR-4753-5p	CLIP-seq
MIRT2578869	hsa-miR-4763-5p	CLIP-seq
MIRT2051319	hsa-miR-4796-3p	CLIP-seq
MIRT2578870	hsa-miR-489	CLIP-seq
MIRT2578871	hsa-miR-513a-5p	CLIP-seq
MIRT2051320	hsa-miR-520g	CLIP-seq
MIRT2051321	hsa-miR-520h	CLIP-seq
MIRT2578872	hsa-miR-541	CLIP-seq
MIRT2578873	hsa-miR-550a	CLIP-seq
MIRT2578874	hsa-miR-582-3p	CLIP-seq
MIRT2578875	hsa-miR-618	CLIP-seq
MIRT2051322	hsa-miR-628-5p	CLIP-seq
MIRT2578877	hsa-miR-645	CLIP-seq
MIRT2578878	hsa-miR-654-5p	CLIP-seq
MIRT2051323	hsa-miR-661	CLIP-seq
MIRT2578879	hsa-miR-708	CLIP-seq
MIRT2578880	hsa-miR-767-3p	CLIP-seq
MIRT2578881	hsa-miR-770-5p	CLIP-seq
MIRT2578882	hsa-miR-873	CLIP-seq
MIRT2578883	hsa-miR-936	CLIP-seq
MIRT2578884	hsa-miR-940	CLIP-seq

Show/Hide all (14)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000122	Process	Negative regulation of transcription by RNA polymerase II	NAS	25755249
GO:0003682	Function	Chromatin binding	IEA
GO:0003714	Function	Transcription corepressor activity	NAS	25755249
GO:0003723	Function	RNA binding	HDA	22681889
GO:0005515	Function	Protein binding	IPI	11113208
GO:0005615	Component	Extracellular space	HDA	22664934
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IBA
GO:0005654	Component	Nucleoplasm	IDA
GO:0008286	Process	Insulin receptor signaling pathway	IEA
GO:0009966	Process	Regulation of signal transduction	IBA
GO:0015629	Component	Actin cytoskeleton	IDA
GO:0042593	Process	Glucose homeostasis	IEA
GO:0046627	Process	Negative regulation of insulin receptor signaling pathway	IEA

MIM	HGNC	e!Ensembl
616825	15909	ENSG00000124160

Q9HCD5

Protein name

Nuclear receptor coactivator 5 (NCoA-5) (Coactivator independent of AF-2) (CIA)

Protein function

Nuclear receptor coregulator that can have both coactivator and corepressor functions. Interacts with nuclear receptors for steroids (ESR1 and ESR2) independently of the steroid binding domain (AF-2) of the ESR receptors, and with the orphan nuc

PDB

1V95 , 2J7X , 2J7Y , 4ZI1

Family and domains

Tissue specificity

TISSUE SPECIFICITY: Widely expressed.

Sequence

MNTAPSRPSPTRRDPYGFGDSRDSRRDRSPIRGSPRREPRDGRNGRDARDSRDIRDPRDL
RDHRHSRDLRDHRDSRSVRDVRDVRDLRDFRDLRDSRDFRDQRDPMYDRYRDMRDSRDPM
YRREGSYDRYLRMDDYCRRKDDSYFDRYRDSFDGRGPPGPESQSRAKERLKREERRREEL
YRQYFEEIQRRFDAERPVDCSVIVVNKQTKDYAESVGRKVRDLGMVVDLIFLNTEVSLSQ
ALEDVSRGGSPFAIVITQQHQIHRSCTVNIMFGTPQEHRNMPQADAMVLVARNYERYKNE
CREKEREEIARQAAKMADEAILQERERGGPEEGVRGGHPPAIQSLINLLADNRYLTAEET
DKIINYLRERKERLMRSSTDSLPGPISRQPLGATSGASLKTQPSSQPLQSGQVLPSATPT
PSAPPTSQQELQAKILSLFNSGTVTANSSSASPSVAAGNTPNQNFSTAANSQPQQRSQAS
GNQPPSILGQGGSAQNMGPRPGAPSQGLFGQPSSRLAPASNMTSQRPVSSTGINFDNPSV
QKALDTLIQSGPALSHLVSQTTAQMGQPQAPMGSYQRHY

Sequence length

579

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (20)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
ANOREXIA NERVOSA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ANXIETY DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATRIAL FIBRILLATION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AUTISM SPECTRUM DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BIPOLAR DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
DIFFUSE LARGE B-CELL LYMPHOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FOLLICULAR LYMPHOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HODGKINS LYMPHOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTHYROIDISM	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MAJOR DEPRESSIVE DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MOOD DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
MULTIPLE SCLEROSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NEUROTIC DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OBESITY	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
POST-TRAUMATIC STRESS DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSYCHIATRIC DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SCHIZOPHRENIA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (35)

Disease Name	Disease (Merged)	Source	PMID	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Agranulocytosis	Agranulocytosis	BEFREE	21483481	★★★★★ ★☆☆☆☆ Found in Text Mining only
Anemia	Anemia	BEFREE	30566627, 31161461	★★★★★ ★☆☆☆☆ Found in Text Mining only
Arthritis	Arthritis	BEFREE	12483744, 23341540, 24836681, 26947206, 27460490, 28013195, 28249243, 28539269, 28957555, 29268189, 29361119, 30344681, 30649471, 30755337, 30800133 View all (5 more)	★★★★★ ★☆☆☆☆ Found in Text Mining only
Autoimmune Diseases	Autoimmune Diseases	BEFREE	21645569	★★★★★ ★☆☆☆☆ Found in Text Mining only
Behcet Syndrome	Behcet Syndrome	BEFREE	28694762	★★★★★ ★☆☆☆☆ Found in Text Mining only
Bone Diseases	Bone Disease	BEFREE	22884682	★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	27847318	★★★★★ ★☆☆☆☆ Found in Text Mining only
cervical cancer	Cervical Cancer	BEFREE	30335900	★★★★★ ★☆☆☆☆ Found in Text Mining only
Cervix carcinoma	Cervix carcinoma	BEFREE	30335900	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	29296214	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent	Diabetes Mellitus	BEFREE	24332041, 28137631	★★★★★ ★☆☆☆☆ Found in Text Mining only
Diffuse Large B-Cell Lymphoma	Diffuse Lymphoma	GWASCAT_DG	31407831	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Hodgkin Disease	Hodgkin Disease	GWASCAT_DG	30194254	★★★★★ ★☆☆☆☆ Found in Text Mining only
Leukopenia	Leukopenia	BEFREE	31161461	★★★★★ ★☆☆☆☆ Found in Text Mining only
Liver carcinoma	Liver carcinoma	BEFREE	24332041, 28137631, 29626478	★★★★★ ★☆☆☆☆ Found in Text Mining only
Major Depressive Disorder	Mental Depression	GWASCAT_DG	29942085	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Malignant neoplasm of breast	Breast Cancer	BEFREE	27847318	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of thyroid	Thyroid cancer	BEFREE	29391807	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	27847318, 29296214, 29391807, 29626478	★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant tumor of cervix	Cervical Tumor	BEFREE	30335900	★★★★★ ★☆☆☆☆ Found in Text Mining only
Marginal Zone B-Cell Lymphoma	B-Cell Lymphoma	GWASCAT_DG	31407831	★★★★★ ★☆☆☆☆ Found in Text Mining only
melanoma	Melanoma	BEFREE	28704130	★★★★★ ★☆☆☆☆ Found in Text Mining only
Mood Disorders	Mood Disorder	GWASCAT_DG	29942085	★★★★★ ★☆☆☆☆ Found in Text Mining only
Multiple Sclerosis	Multiple Sclerosis	GWASCAT_DG	21833088, 31407831	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Multiple Sclerosis	Multiple Sclerosis	GWASDB_DG	21833088	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Neoplasms	Neoplasms	BEFREE	24332041, 28704130, 29296214, 29391807, 30335900	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neutropenia	Neutropenia	BEFREE	31161461	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteopenia	Osteopenia	BEFREE	28957555	★★★★★ ★☆☆☆☆ Found in Text Mining only
Osteosarcoma	Osteosarcoma	BEFREE	29434886	★★★★★ ★☆☆☆☆ Found in Text Mining only
Papillary thyroid carcinoma	Papillary thyroid carcinoma	BEFREE	29391807	★★★★★ ★☆☆☆☆ Found in Text Mining only
Psoriasis	Psoriasis	BEFREE	21645569	★★★★★ ★☆☆☆☆ Found in Text Mining only
Rheumatoid Arthritis	Rheumatoid arthritis	BEFREE	12483744, 21645569, 22884682, 26947206, 28900117, 29031206, 30344681, 30649471, 31739383, 31831067, 31843461	★★★★★ ★☆☆☆☆ Found in Text Mining only
Skin Erosion	Skin Erosion	BEFREE	29031206, 31076346	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid carcinoma	Thyroid Carcinoma	BEFREE	29391807	★★★★★ ★☆☆☆☆ Found in Text Mining only
Thyroid Neoplasm	Thyroid Neoplasm	BEFREE	29391807	★★★★★ ★☆☆☆☆ Found in Text Mining only

NCOA5 (nuclear receptor coactivator 5)