Gene Gene information from NCBI Gene database.
Entrez ID 57708
Gene name MIER1 transcriptional regulator
Gene symbol MIER1
Synonyms (NCBI Gene)
ER1MI-ER1
Chromosome 1
Chromosome location 1p31.3
Summary This gene encodes a protein that was first identified in Xenopus laevis by its role in a mesoderm induction early response (MIER). The encoded protein functions as a transcriptional regulator. Alternatively spliced transcript variants encode multiple isof
miRNA miRNA information provided by mirtarbase database.
448
miRTarBase ID miRNA Experiments Reference
MIRT024096 hsa-miR-1-3p Microarray 18668037
MIRT044128 hsa-miR-30e-5p CLASH 23622248
MIRT535930 hsa-miR-5197-3p PAR-CLIP 22012620
MIRT535929 hsa-miR-410-3p PAR-CLIP 22012620
MIRT535928 hsa-miR-5586-5p PAR-CLIP 22012620
Gene ontology (GO) Gene Ontology (GO) annotations describing the biological processes, molecular functions, and cellular components associated with a gene.
18
GO ID Ontology Definition Evidence Reference
GO:0000122 Process Negative regulation of transcription by RNA polymerase II IBA
GO:0003714 Function Transcription corepressor activity IBA
GO:0004407 Function Histone deacetylase activity IDA 28046085
GO:0005515 Function Protein binding IPI 12482978, 18451879, 21258344, 23752268, 25416956, 28514442, 32814053, 33961781, 35271311
GO:0005634 Component Nucleus IDA 28046085
Other IDs Other IDs provides unique identifiers for this gene in OMIM, HGNC, and Ensembl databases.
MIM HGNC e!Ensembl
616848 29657 ENSG00000198160
Protein Protein information from UniProt database.
UniProt ID Unique identifier for the protein in the UniProt database. Click to view detailed protein information.
Q8N108
Protein name Mesoderm induction early response protein 1 (Early response 1) (Er1) (Mi-er1) (hMi-er1)
Protein function Transcriptional repressor regulating the expression of a number of genes including SP1 target genes. Probably functions through recruitment of HDAC1 a histone deacetylase involved in chromatin silencing.
Family and domains

Pfam

Accession ID Position in sequence Description Type
PF01448 ELM2 182 233 ELM2 domain Family
PF00249 Myb_DNA-binding 285 331 Myb-like DNA-binding domain Domain
Tissue specificity TISSUE SPECIFICITY: Ubiquitously expressed, but at very low levels. However, consistent level of expression are observed in heart, testis, thyroid, ovary and adrenal gland. Transcripts are up-regulated in breast carcinoma cell lines and tumor. {ECO:000026
Sequence
MAEPSVESSSPGGSATSDDHEFDPSADMLVHDFDDERTLEEEEMMEGETNFSSEIEDLAR
EGDMPIHELLSLYGYGSTVRLPEEDEEEEEEEEEGEDDEDADNDDNSGCSGENKEENIKD
SSGQEDETQSSNDDPSQSVASQDAQEIIRPRRCKYFDTNSEVEEESEEDEDYIPSEDWKK
EIMVGSMFQAEIPVGICRYKENEKVYENDDQLLWDPEYLPEDKVIIFLKDASRRTGDEKG
VEAIPEGSHIKDNEQALYELVKCNFDTEEALRRLRFNVKAAREELSVWTEEECRNFEQGL
KAYGKDFHLIQANKVRTRSVGECVAFYYMWK
KSERYDFFAQQTRFGKKKYNLHPGVTDYM
DRLLDESESAASSRAPSPPPTASNSSNSQSEKEDGTVSTANQNGVSSNGPGEILNKEEVK
VEGLHINGPTGGNKKPLHADMDTNGYETDNLTTDPKLAHMTARNENDFDEKSERPAKRRR
VNSNGKESPGSSEFFQEAVSHGKFEELENTDD
Sequence length 512
Interactions View interactions
Associated diseases Disease associations from ClinVar (causal & non-causal) and other databases (OMIM, Orphanet, GWAS, etc.).
2
Evidence Score: ★☆☆☆☆  Gene-disease association found in Text Mining only ★★☆☆☆  Found in Text Mining and Unknown/Other Associations ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Phenotype Name Clinical Significance Source Evidence Score
INFLAMMATORY BOWEL DISEASE GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
SEASONAL ALLERGIC RHINITIS GWAS catalog
★★☆☆☆
Found in Text Mining + Unknown/Other Associations
Associations from Text Mining Disease associations identified through text mining
Disease Name Disease (Merged) Source PMID Relationship Type Evidence Score
Androgen-Insensitivity Syndrome Androgen-Insensitivity Syndrome BEFREE 22009847
★☆☆☆☆
Found in Text Mining only
Breast Carcinoma Breast Carcinoma BEFREE 22012767
★☆☆☆☆
Found in Text Mining only
Breast Neoplasms Breast neoplasm Pubtator 22384264 Associate
★☆☆☆☆
Found in Text Mining only
Carcinoma Ovarian Epithelial Epithelial ovarian carcinoma Pubtator 34859847 Associate
★☆☆☆☆
Found in Text Mining only
Coronary Artery Disease Coronary artery disease Pubtator 34088265 Associate
★☆☆☆☆
Found in Text Mining only
Cryptorchidism Cryptorchidism BEFREE 17099213
★☆☆☆☆
Found in Text Mining only
Diabetes Mellitus, Non-Insulin-Dependent Diabetes Mellitus BEFREE 21837403
★☆☆☆☆
Found in Text Mining only
Dyslipidemias Dyslipidemias Pubtator 35899893 Associate
★☆☆☆☆
Found in Text Mining only
Malignant neoplasm of breast Breast Cancer BEFREE 22012767
★☆☆☆☆
Found in Text Mining only
Osteoporosis Osteoporosis Pubtator 20357503 Associate
★☆☆☆☆
Found in Text Mining only