Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	57666
Gene name	Fibrosin like 1
Gene symbol	FBRSL1
Synonyms (NCBI Gene)	-
Chromosome	12
Chromosome location	12q24.33

216

Show/Hide all (216)

miRTarBase ID	miRNA	Experiments	Reference
MIRT042565	hsa-miR-423-3p	CLASH	23622248
MIRT739638	hsa-miR-141	CLIP-seq
MIRT739639	hsa-miR-200a	CLIP-seq
MIRT739641	hsa-miR-3130-3p	CLIP-seq
MIRT990204	hsa-miR-3151	CLIP-seq
MIRT990205	hsa-miR-3613-3p	CLIP-seq
MIRT990206	hsa-miR-4447	CLIP-seq
MIRT990207	hsa-miR-4472	CLIP-seq
MIRT990208	hsa-miR-4505	CLIP-seq
MIRT990209	hsa-miR-4646-5p	CLIP-seq
MIRT990210	hsa-miR-4668-5p	CLIP-seq
MIRT990211	hsa-miR-491-5p	CLIP-seq
MIRT990212	hsa-miR-520d-5p	CLIP-seq
MIRT990213	hsa-miR-524-5p	CLIP-seq
MIRT990214	hsa-miR-544	CLIP-seq
MIRT990215	hsa-miR-548m	CLIP-seq
MIRT990216	hsa-miR-625	CLIP-seq
MIRT739640	hsa-miR-767-5p	CLIP-seq
MIRT990217	hsa-miR-885-5p	CLIP-seq
MIRT1548622	hsa-miR-1910	CLIP-seq
MIRT1548623	hsa-miR-3140-5p	CLIP-seq
MIRT1548624	hsa-miR-4786-3p	CLIP-seq
MIRT1993443	hsa-miR-1273e	CLIP-seq
MIRT1993444	hsa-miR-128	CLIP-seq
MIRT1993445	hsa-miR-1281	CLIP-seq
MIRT1993446	hsa-miR-1292	CLIP-seq
MIRT1993447	hsa-miR-139-5p	CLIP-seq
MIRT739638	hsa-miR-141	CLIP-seq
MIRT1993448	hsa-miR-142-5p	CLIP-seq
MIRT1993449	hsa-miR-147	CLIP-seq
MIRT1993450	hsa-miR-185	CLIP-seq
MIRT1548622	hsa-miR-1910	CLIP-seq
MIRT739639	hsa-miR-200a	CLIP-seq
MIRT1993451	hsa-miR-218	CLIP-seq
MIRT1993452	hsa-miR-2277-3p	CLIP-seq
MIRT1993453	hsa-miR-27a	CLIP-seq
MIRT1993454	hsa-miR-27b	CLIP-seq
MIRT739641	hsa-miR-3130-3p	CLIP-seq
MIRT1993455	hsa-miR-3134	CLIP-seq
MIRT1548623	hsa-miR-3140-5p	CLIP-seq
MIRT990204	hsa-miR-3151	CLIP-seq
MIRT1993456	hsa-miR-3168	CLIP-seq
MIRT1993457	hsa-miR-3176	CLIP-seq
MIRT1993458	hsa-miR-340	CLIP-seq
MIRT1993459	hsa-miR-3609	CLIP-seq
MIRT1993460	hsa-miR-3618	CLIP-seq
MIRT1993461	hsa-miR-3621	CLIP-seq
MIRT1993462	hsa-miR-3653	CLIP-seq
MIRT1993463	hsa-miR-3656	CLIP-seq
MIRT1993464	hsa-miR-3658	CLIP-seq
MIRT1993465	hsa-miR-3663-5p	CLIP-seq
MIRT1993466	hsa-miR-3691-3p	CLIP-seq
MIRT1993467	hsa-miR-3914	CLIP-seq
MIRT1993468	hsa-miR-3922-3p	CLIP-seq
MIRT1993469	hsa-miR-3922-5p	CLIP-seq
MIRT1993470	hsa-miR-4300	CLIP-seq
MIRT1993471	hsa-miR-4306	CLIP-seq
MIRT1993472	hsa-miR-4420	CLIP-seq
MIRT1993473	hsa-miR-4433	CLIP-seq
MIRT1993474	hsa-miR-4446-3p	CLIP-seq
MIRT990206	hsa-miR-4447	CLIP-seq
MIRT1993475	hsa-miR-4467	CLIP-seq
MIRT1993476	hsa-miR-4471	CLIP-seq
MIRT990207	hsa-miR-4472	CLIP-seq
MIRT1993477	hsa-miR-4481	CLIP-seq
MIRT1993478	hsa-miR-4488	CLIP-seq
MIRT1993479	hsa-miR-4492	CLIP-seq
MIRT1993480	hsa-miR-4498	CLIP-seq
MIRT1993481	hsa-miR-4530	CLIP-seq
MIRT1993482	hsa-miR-4534	CLIP-seq
MIRT1993483	hsa-miR-4632	CLIP-seq
MIRT1993484	hsa-miR-4638-3p	CLIP-seq
MIRT1993485	hsa-miR-4640-5p	CLIP-seq
MIRT1993486	hsa-miR-4644	CLIP-seq
MIRT990210	hsa-miR-4668-5p	CLIP-seq
MIRT1993487	hsa-miR-4685-5p	CLIP-seq
MIRT1993488	hsa-miR-4697-5p	CLIP-seq
MIRT1993489	hsa-miR-4726-5p	CLIP-seq
MIRT1993490	hsa-miR-4734	CLIP-seq
MIRT1993491	hsa-miR-4742-3p	CLIP-seq
MIRT1993492	hsa-miR-4745-5p	CLIP-seq
MIRT1993493	hsa-miR-4746-3p	CLIP-seq
MIRT1993494	hsa-miR-4758-5p	CLIP-seq
MIRT1993495	hsa-miR-4777-5p	CLIP-seq
MIRT1548624	hsa-miR-4786-3p	CLIP-seq
MIRT1993496	hsa-miR-489	CLIP-seq
MIRT990211	hsa-miR-491-5p	CLIP-seq
MIRT1993497	hsa-miR-503	CLIP-seq
MIRT1993498	hsa-miR-512-3p	CLIP-seq
MIRT990212	hsa-miR-520d-5p	CLIP-seq
MIRT1993499	hsa-miR-520g	CLIP-seq
MIRT1993500	hsa-miR-520h	CLIP-seq
MIRT990213	hsa-miR-524-5p	CLIP-seq
MIRT1993501	hsa-miR-548ah	CLIP-seq
MIRT990215	hsa-miR-548m	CLIP-seq
MIRT1993502	hsa-miR-572	CLIP-seq
MIRT1993503	hsa-miR-598	CLIP-seq
MIRT1993504	hsa-miR-599	CLIP-seq
MIRT1993505	hsa-miR-601	CLIP-seq
MIRT1993506	hsa-miR-604	CLIP-seq
MIRT990216	hsa-miR-625	CLIP-seq
MIRT1993507	hsa-miR-629	CLIP-seq
MIRT1993508	hsa-miR-636	CLIP-seq
MIRT1993509	hsa-miR-661	CLIP-seq
MIRT1993510	hsa-miR-665	CLIP-seq
MIRT1993511	hsa-miR-758	CLIP-seq
MIRT1993512	hsa-miR-762	CLIP-seq
MIRT739640	hsa-miR-767-5p	CLIP-seq
MIRT1993513	hsa-miR-802	CLIP-seq
MIRT990217	hsa-miR-885-5p	CLIP-seq
MIRT1993514	hsa-miR-920	CLIP-seq
MIRT2227326	hsa-miR-1249	CLIP-seq
MIRT1993444	hsa-miR-128	CLIP-seq
MIRT1993445	hsa-miR-1281	CLIP-seq
MIRT1993446	hsa-miR-1292	CLIP-seq
MIRT2227327	hsa-miR-1299	CLIP-seq
MIRT2227328	hsa-miR-153	CLIP-seq
MIRT1993450	hsa-miR-185	CLIP-seq
MIRT1548622	hsa-miR-1910	CLIP-seq
MIRT1993453	hsa-miR-27a	CLIP-seq
MIRT1993454	hsa-miR-27b	CLIP-seq
MIRT2227329	hsa-miR-3074-3p	CLIP-seq
MIRT2227330	hsa-miR-3135b	CLIP-seq
MIRT1548623	hsa-miR-3140-5p	CLIP-seq
MIRT990204	hsa-miR-3151	CLIP-seq
MIRT1993457	hsa-miR-3176	CLIP-seq
MIRT2227331	hsa-miR-3607-3p	CLIP-seq
MIRT2227332	hsa-miR-3620	CLIP-seq
MIRT1993461	hsa-miR-3621	CLIP-seq
MIRT2227333	hsa-miR-3652	CLIP-seq
MIRT1993462	hsa-miR-3653	CLIP-seq
MIRT1993463	hsa-miR-3656	CLIP-seq
MIRT1993464	hsa-miR-3658	CLIP-seq
MIRT2227334	hsa-miR-3686	CLIP-seq
MIRT1993466	hsa-miR-3691-3p	CLIP-seq
MIRT1993468	hsa-miR-3922-3p	CLIP-seq
MIRT1993469	hsa-miR-3922-5p	CLIP-seq
MIRT2227335	hsa-miR-421	CLIP-seq
MIRT2227336	hsa-miR-4261	CLIP-seq
MIRT1993471	hsa-miR-4306	CLIP-seq
MIRT1993472	hsa-miR-4420	CLIP-seq
MIRT2227337	hsa-miR-4430	CLIP-seq
MIRT1993474	hsa-miR-4446-3p	CLIP-seq
MIRT990206	hsa-miR-4447	CLIP-seq
MIRT1993475	hsa-miR-4467	CLIP-seq
MIRT1993476	hsa-miR-4471	CLIP-seq
MIRT990207	hsa-miR-4472	CLIP-seq
MIRT2227338	hsa-miR-448	CLIP-seq
MIRT1993477	hsa-miR-4481	CLIP-seq
MIRT1993478	hsa-miR-4488	CLIP-seq
MIRT1993479	hsa-miR-4492	CLIP-seq
MIRT1993480	hsa-miR-4498	CLIP-seq
MIRT1993481	hsa-miR-4530	CLIP-seq
MIRT1993483	hsa-miR-4632	CLIP-seq
MIRT1993485	hsa-miR-4640-5p	CLIP-seq
MIRT1993486	hsa-miR-4644	CLIP-seq
MIRT990210	hsa-miR-4668-5p	CLIP-seq
MIRT1993487	hsa-miR-4685-5p	CLIP-seq
MIRT1993488	hsa-miR-4697-5p	CLIP-seq
MIRT2227339	hsa-miR-4709-5p	CLIP-seq
MIRT1993489	hsa-miR-4726-5p	CLIP-seq
MIRT1993490	hsa-miR-4734	CLIP-seq
MIRT1993491	hsa-miR-4742-3p	CLIP-seq
MIRT1993492	hsa-miR-4745-5p	CLIP-seq
MIRT1993494	hsa-miR-4758-5p	CLIP-seq
MIRT2227340	hsa-miR-4782-5p	CLIP-seq
MIRT1993496	hsa-miR-489	CLIP-seq
MIRT990211	hsa-miR-491-5p	CLIP-seq
MIRT1993497	hsa-miR-503	CLIP-seq
MIRT2227341	hsa-miR-516b	CLIP-seq
MIRT990212	hsa-miR-520d-5p	CLIP-seq
MIRT990213	hsa-miR-524-5p	CLIP-seq
MIRT990215	hsa-miR-548m	CLIP-seq
MIRT2227342	hsa-miR-553	CLIP-seq
MIRT2227343	hsa-miR-570	CLIP-seq
MIRT1993506	hsa-miR-604	CLIP-seq
MIRT990216	hsa-miR-625	CLIP-seq
MIRT1993507	hsa-miR-629	CLIP-seq
MIRT1993509	hsa-miR-661	CLIP-seq
MIRT1993511	hsa-miR-758	CLIP-seq
MIRT1993512	hsa-miR-762	CLIP-seq
MIRT739640	hsa-miR-767-5p	CLIP-seq
MIRT2227344	hsa-miR-875-3p	CLIP-seq
MIRT990217	hsa-miR-885-5p	CLIP-seq
MIRT2227345	hsa-miR-889	CLIP-seq
MIRT1993444	hsa-miR-128	CLIP-seq
MIRT1993449	hsa-miR-147	CLIP-seq
MIRT1993453	hsa-miR-27a	CLIP-seq
MIRT1993454	hsa-miR-27b	CLIP-seq
MIRT1993457	hsa-miR-3176	CLIP-seq
MIRT2227332	hsa-miR-3620	CLIP-seq
MIRT1993466	hsa-miR-3691-3p	CLIP-seq
MIRT1993468	hsa-miR-3922-3p	CLIP-seq
MIRT1993474	hsa-miR-4446-3p	CLIP-seq
MIRT990206	hsa-miR-4447	CLIP-seq
MIRT990207	hsa-miR-4472	CLIP-seq
MIRT1993477	hsa-miR-4481	CLIP-seq
MIRT1993478	hsa-miR-4488	CLIP-seq
MIRT1993479	hsa-miR-4492	CLIP-seq
MIRT1993480	hsa-miR-4498	CLIP-seq
MIRT1993481	hsa-miR-4530	CLIP-seq
MIRT1993488	hsa-miR-4697-5p	CLIP-seq
MIRT1993492	hsa-miR-4745-5p	CLIP-seq
MIRT1993494	hsa-miR-4758-5p	CLIP-seq
MIRT1993504	hsa-miR-599	CLIP-seq
MIRT1993512	hsa-miR-762	CLIP-seq
MIRT1993473	hsa-miR-4433	CLIP-seq
MIRT1993483	hsa-miR-4632	CLIP-seq
MIRT1993498	hsa-miR-512-3p	CLIP-seq
MIRT1993510	hsa-miR-665	CLIP-seq
MIRT2531289	hsa-miR-1207-5p	CLIP-seq
MIRT2531290	hsa-miR-3622b-5p	CLIP-seq
MIRT2531291	hsa-miR-4253	CLIP-seq
MIRT2531292	hsa-miR-4761-3p	CLIP-seq
MIRT2531293	hsa-miR-4763-3p	CLIP-seq
MIRT2531294	hsa-miR-486-3p	CLIP-seq

Show/Hide all (1)

GO ID	Ontology	Definition	Evidence	Reference
GO:0003723	Function	RNA binding	HDA	22681889

MIM	HGNC	e!Ensembl
620123	29308	ENSG00000112787

Q9HCM7

Protein name

Fibrosin-1-like protein (AUTS2-like protein) (HBV X-transactivated gene 9 protein) (HBV XAg-transactivated protein 9)

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF15336	Auts2	587 → 791	Autism susceptibility gene 2 protein	Family

Sequence

MEAKVRPSRRSRAQRDRGRRREAARDARAQSPSSGDEPEPSPGKENAGLRGAPPRGAAPA
PRTARPPRRRRRESSSQEEEVIDGFAIASFSTLEALEKDMALKPHERKEKWERRLIKKPR
ESETCPPAEPSENRRPLEAGSPGQDLEPACDGARKVPLQPSKQMKVTVSKGGDRDSDDDS
VLEATSSRDPLSDSSAHAVSGRGYSCDSESGPDDKASVGSEKLFAPGTDKGPALEKSEAK
AGPVPKVSGLERSRELSAESFLPTASPAPHAAPCPGPPPGSRANPLVKKEPPAPHRHTPQ
PPPPQPRGLLPTHVPASLGAFAGHSQAAANGLHGLSRSSSAPLGLGKHVSLSPHGPGPHL
STSHLALRSQAQHQLHAAMFAAPPTLPPPPALPASSLVLPGHPADHELLRQELNTRFLVQ
SAERPGASLGPGALLRAEFHQHQHTHQHTHQHTHQHQHTFAPFPAGLPPTPPAAPPPFDK
YAPKLDSPYFRHSSVSFFPSFPPAIPGLPTLLPHPGPFGSLQGAFQPKVSDPYRAVVKVS
TCWEGPWQGRTLVPPGRPRGARDSRSLQKTWVGVAPAPLSASILSQKPGRWCAVHVQIAW
QIYRHQQKIKEMQLDPHKLEVGAKLDLFGRPPAPGVFAGFHYPQDLARPLFPSTGAAHPA
SNPFGPSAHPGSFLPTGPLTDPFSRPSTFGGLGSLSSHAFGGLGSHALAPGGSIFAPKEG
SSVHGLPSPHEAWNRLHRAPPSFPAPPPWPKSVDAERVSALTNHDREPDNGKEEQERDLL
EKTRLLSRASPATPAGHPVSGLLLRAQSELGRSGAPAEREAEPRVKESRSPAKEEAAKMP
ARASPPHSKAAPGDVKVKEERGEDEASEPPAGGLHPAPLQLGLGRERLGAPGFAWEPFRG
LELPRRAFPAAAPAPGSAALLEPPERPYRDREPHGYSPERLRGELERARAPHLPPAAPAL
DGALLPSLGALHFPRLSPAALHNGLLARTPPAAAALGAPPPLVTAAGPPTPPGPPRSRTT
PLGGLGPGEARDYSPSRNPPEVEAR

Sequence length

1045

Interactions

View interactions

	KEGG
	Polycomb repressive complex

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Causal Diseases (1)

Phenotype Name	Clinical Significance	dbSNP ID	RCV Accession	Evidence Score
Causal Diseases associated with Pathogenic or Likely Pathogenic variants in ClinVar
Moyamoya angiopathy	Likely pathogenic	rs2040109939	RCV004704493	★★★★★ ★★★★☆ ClinVar: Pathogenic / Likely Pathogenic (<5 Variants)

Show/Hide Unknown Diseases (41)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
AORTIC STENOSIS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
AORTIC VALVE CALCIFICATION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATRIAL FIBRILLATION	—	CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog CTD, Disgenet, GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BASAL CELL CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BILIARY TRACT CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CARDIOVASCULAR DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CERVICAL CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COMPLEX NEURODEVELOPMENTAL DISORDER	—	GenCC	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
CORONARY ARTERY DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ENDOMETRIAL CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESOPHAGEAL CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ESTROGEN-RECEPTOR NEGATIVE BREAST CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FBRSL1-associated neurodevelopmental syndrome	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FBRSL1-related disorder	Uncertain significance; Benign; Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
FEMALE REPRODUCTIVE SYSTEM DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GASTRIC CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
GOUT	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HEPATOCELLULAR CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
HYPERTENSION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG ADENOCARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
LUNG CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
METABOLIC SYNDROME	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-HODGKINS LYMPHOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
NON-SPECIFIC SYNDROMIC INTELLECTUAL DISABILITY	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN ENDOMETRIOID CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
OVARIAN SEROUS CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PANCREATIC CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PARKINSON DISEASE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CANCER, FAMILIAL	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SQUAMOUS CELL LUNG CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Syndromic disease	Benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SYSTEMIC LUPUS ERYTHEMATOSUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (10)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Asthma	Asthma	Pubtator	35597955	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Atrial Fibrillation	Atrial Fibrillation	CTD_human_DG	29892015, 30061737		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Atrial Fibrillation	Atrial Fibrillation	GWASCAT_DG	30061737		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Coronary Artery Disease	Coronary artery disease	GWASCAT_DG	30525989		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
melanoma	Melanoma	BEFREE	23659246		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	23659246	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Paroxysmal atrial fibrillation	Paroxysmal atrial fibrillation	CTD_human_DG	29892015, 30061737		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate cancer, familial	Prostate cancer	CTD_human_DG	29892016		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATE CANCER, HEREDITARY, 1	Prostate Cancer, Hereditary	CTD_human_DG	29892016		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostate carcinoma	Prostate cancer	GWASCAT_DG	29892016		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

FBRSL1 (fibrosin like 1)