USP29 (ubiquitin specific peptidase 29)

Gene

• Entrez ID: 57663
• Gene name: Ubiquitin specific peptidase 29
• Gene symbol: USP29
• Synonyms (NCBI Gene): HOM-TES-84/86
• Chromosome: 19
• Chromosome location: 19q13.43

miRNA

miRTarBase ID	miRNA	Experiments	Reference
MIRT016785	hsa-miR-335-5p	Microarray	18185580
MIRT1478562	hsa-miR-1200	CLIP-seq
MIRT1478563	hsa-miR-1298	CLIP-seq
MIRT1478564	hsa-miR-205	CLIP-seq
MIRT1478565	hsa-miR-4324	CLIP-seq
MIRT1478566	hsa-miR-4326	CLIP-seq
MIRT1478567	hsa-miR-4793-5p	CLIP-seq
MIRT1478568	hsa-miR-544b	CLIP-seq
MIRT2694815	hsa-miR-1228	CLIP-seq
MIRT2694816	hsa-miR-4711-5p	CLIP-seq
MIRT2694817	hsa-miR-544	CLIP-seq

Gene ontology (GO)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000082	Process	G1/S transition of mitotic cell cycle	IBA
GO:0002376	Process	Immune system process	IEA
GO:0004197	Function	Cysteine-type endopeptidase activity	ISS
GO:0004843	Function	Cysteine-type deubiquitinase activity	IBA
GO:0004843	Function	Cysteine-type deubiquitinase activity	IEA
GO:0004843	Function	Cysteine-type deubiquitinase activity	TAS	10958632
GO:0005515	Function	Protein binding	IPI	38233848
GO:0005634	Component	Nucleus	IBA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IBA
GO:0006508	Process	Proteolysis	IEA
GO:0008233	Function	Peptidase activity	IEA
GO:0008234	Function	Cysteine-type peptidase activity	IEA
GO:0016579	Process	Protein deubiquitination	IEA
GO:0016787	Function	Hydrolase activity	IEA
GO:0031647	Process	Regulation of protein stability	IBA
GO:0045087	Process	Innate immune response	IEA
GO:0048471	Component	Perinuclear region of cytoplasm	IEA
GO:0050821	Process	Protein stabilization	ISS
GO:0051607	Process	Defense response to virus	ISS
GO:0060340	Process	Positive regulation of type I interferon-mediated signaling pathway	ISS
GO:0071108	Process	Protein K48-linked deubiquitination	ISS
GO:0101005	Function	Deubiquitinase activity	IEA

Other IDs

• MIM: 609546
• HGNC: 18563
• e!Ensembl: ENSG00000131864

Protein

• UniProt ID: Q9HBJ7
• Protein name: Ubiquitin carboxyl-terminal hydrolase 29 (EC 3.4.19.12) (Deubiquitinating enzyme 29) (Ubiquitin thioesterase 29) (Ubiquitin-specific-processing protease 29)
• Protein function: Deubiquitinase involved in innate antiviral immunity by mediating 'Lys-48'-linked deubiquitination of CGAS, thereby promoting its stabilization.
• Family and domains:

  Pfam

  Accession	ID	Position in sequence	Description	Type
  PF16674	UCH_N	1 → 105	N-terminal of ubiquitin carboxyl-terminal hydrolase 37	Domain
  PF00443	UCH	285 → 882	Ubiquitin carboxyl-terminal hydrolase	Family

• Sequence:

  MISLKVCGFIQIWSQKTGMTKLKEALIETVQRQKEIKLVVTFKSGKFIRIFQLSNNIRSV
  VLRHCKKRQSHLRLTLKNNVFLFIDKLSYRDAKQLNMFLDIIHQNKSQQPMKSDDDWSVF
  ESRNMLKEIDKTSFYSICNKPSYQKMPLFMSKSPTHVKKGILENQGGKGQNTLSSDVQTN
  EDILKEDNPVPNKKYKTDSLKYIQSNRKNPSSLEDLEKDRDLKLGPSFNTNCNGNPNLDE
  TVLATQTLNAKNGLTSPLEPEHSQGDPRCNKAQVPLDSHSQQLQQGFPNLGNTCYMNAVL
  QSLFAIPSFADDLLTQGVPWEYIPFEALIMTLTQLLALKDFCSTKIKRELLGNVKKVISA
  VAEIFSGNMQNDAHEFLGQCLDQLKEDMEKLNATLNTGKECGDENSSPQMHVGSAATKVF
  VCPVVANFEFELQLSLICKACGHAVLKVEPNNYLSINLHQETKPLPLSIQNSLDLFFKEE
  ELEYNCQMCKQKSCVARHTFSRLSRVLIIHLKRYSFNNAWLLVKNNEQVYIPKSLSLSSY
  CNESTKPPLPLSSSAPVGKCEVLEVSQEMISEINSPLTPSMKLTSESSDSLVLPVEPDKN
  ADLQRFQRDCGDASQEQHQRDLENGSALESELVHFRDRAIGEKELPVADSLMDQGDISLP
  VMYEDGGKLISSPDTRLVEVHLQEVPQHPELQKYEKTNTFVEFNFDSVTESTNGFYDCKE
  NRIPEGSQGMAEQLQQCIEESIIDEFLQQAPPPGVRKLDAQEHTEETLNQSTELRLQKAD
  LNHLGALGSDNPGNKNILDAENTRGEAKELTRNVKMGDPLQAYRLISVVSHIGSSPNSGH
  YISDVYDFQKQAWFTYNDLCVSEISETKMQEARLHSGYIFFYMHNGIFEELLRKAENSRL
  PSTQAGVIPQGEYEGDSLYRPA

• Sequence length: 922

Associated diseases

Evidence Score:

• ★☆☆☆☆  Gene-disease association found in Text Mining only
• ★★☆☆☆  Found in Text Mining and Unknown/Other Associations
• ★★★☆☆  Reported in Unknown/Other Associations across ≥2 Sources
• ★★★★☆  ClinVar: Pathogenic/Likely Pathogenic (<5 Variants)
• ★★★★★  ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Unknown / Other Associations
Phenotype Name	Clinical Significance	Source	Evidence Score
ALZHEIMER DISEASE	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
COLORECTAL CANCER	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations
TYPE 2 DIABETES MELLITUS	—	GWAS catalog	★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Associations from Text Mining
Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	34573430	Associate	★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	37463886	Associate	★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	36782089	Associate	★☆☆☆☆ Found in Text Mining only