Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Associated diseases
Entrez ID	57658
Gene name	Calcium binding and coiled-coil domain 1
Gene symbol	CALCOCO1
Synonyms (NCBI Gene)	CocoaPP13275calphoglin
Chromosome	12
Chromosome location	12q13.13

Show/Hide all (88)

miRTarBase ID	miRNA	Experiments
MIRT858816	hsa-miR-3074-3p	CLIP-seq
MIRT858817	hsa-miR-3134	CLIP-seq
MIRT858818	hsa-miR-3201	CLIP-seq
MIRT858819	hsa-miR-3605-5p	CLIP-seq
MIRT858820	hsa-miR-3616-5p	CLIP-seq
MIRT858821	hsa-miR-3647-5p	CLIP-seq
MIRT858822	hsa-miR-3659	CLIP-seq
MIRT858823	hsa-miR-3944-5p	CLIP-seq
MIRT858824	hsa-miR-4271	CLIP-seq
MIRT858825	hsa-miR-4658	CLIP-seq
MIRT858826	hsa-miR-4687-3p	CLIP-seq
MIRT858827	hsa-miR-4716-3p	CLIP-seq
MIRT858828	hsa-miR-4725-3p	CLIP-seq
MIRT858829	hsa-miR-4791	CLIP-seq
MIRT858830	hsa-miR-4795-5p	CLIP-seq
MIRT858831	hsa-miR-573	CLIP-seq
MIRT858832	hsa-miR-574-5p	CLIP-seq
MIRT858833	hsa-miR-586	CLIP-seq
MIRT858834	hsa-miR-625	CLIP-seq
MIRT1546054	hsa-miR-1276	CLIP-seq
MIRT858819	hsa-miR-3605-5p	CLIP-seq
MIRT858832	hsa-miR-574-5p	CLIP-seq
MIRT1954973	hsa-miR-486-3p	CLIP-seq
MIRT858832	hsa-miR-574-5p	CLIP-seq
MIRT2192587	hsa-miR-361-5p	CLIP-seq
MIRT858822	hsa-miR-3659	CLIP-seq
MIRT858823	hsa-miR-3944-5p	CLIP-seq
MIRT858825	hsa-miR-4658	CLIP-seq
MIRT858826	hsa-miR-4687-3p	CLIP-seq
MIRT1954973	hsa-miR-486-3p	CLIP-seq
MIRT858832	hsa-miR-574-5p	CLIP-seq
MIRT858822	hsa-miR-3659	CLIP-seq
MIRT858825	hsa-miR-4658	CLIP-seq
MIRT858832	hsa-miR-574-5p	CLIP-seq
MIRT2495793	hsa-miR-122	CLIP-seq
MIRT2495794	hsa-miR-1324	CLIP-seq
MIRT2495795	hsa-miR-146a	CLIP-seq
MIRT2495796	hsa-miR-146b-5p	CLIP-seq
MIRT2495797	hsa-miR-2964a-5p	CLIP-seq
MIRT2495798	hsa-miR-3119	CLIP-seq
MIRT2495799	hsa-miR-3145-5p	CLIP-seq
MIRT2495800	hsa-miR-3166	CLIP-seq
MIRT2495801	hsa-miR-3189-5p	CLIP-seq
MIRT2495802	hsa-miR-3649	CLIP-seq
MIRT858822	hsa-miR-3659	CLIP-seq
MIRT2495803	hsa-miR-3919	CLIP-seq
MIRT858823	hsa-miR-3944-5p	CLIP-seq
MIRT2495804	hsa-miR-4260	CLIP-seq
MIRT2495805	hsa-miR-4324	CLIP-seq
MIRT2495806	hsa-miR-4475	CLIP-seq
MIRT858825	hsa-miR-4658	CLIP-seq
MIRT2495807	hsa-miR-4711-5p	CLIP-seq
MIRT2495808	hsa-miR-4758-3p	CLIP-seq
MIRT2495809	hsa-miR-4771	CLIP-seq
MIRT1954973	hsa-miR-486-3p	CLIP-seq
MIRT2495810	hsa-miR-492	CLIP-seq
MIRT2495811	hsa-miR-510	CLIP-seq
MIRT858832	hsa-miR-574-5p	CLIP-seq
MIRT858833	hsa-miR-586	CLIP-seq
MIRT2495812	hsa-miR-589	CLIP-seq
MIRT2495813	hsa-miR-595	CLIP-seq
MIRT2495793	hsa-miR-122	CLIP-seq
MIRT2495794	hsa-miR-1324	CLIP-seq
MIRT2495795	hsa-miR-146a	CLIP-seq
MIRT2495796	hsa-miR-146b-5p	CLIP-seq
MIRT2495797	hsa-miR-2964a-5p	CLIP-seq
MIRT2495798	hsa-miR-3119	CLIP-seq
MIRT2495799	hsa-miR-3145-5p	CLIP-seq
MIRT2495800	hsa-miR-3166	CLIP-seq
MIRT2495801	hsa-miR-3189-5p	CLIP-seq
MIRT2495802	hsa-miR-3649	CLIP-seq
MIRT858822	hsa-miR-3659	CLIP-seq
MIRT2495803	hsa-miR-3919	CLIP-seq
MIRT858823	hsa-miR-3944-5p	CLIP-seq
MIRT2495804	hsa-miR-4260	CLIP-seq
MIRT2495805	hsa-miR-4324	CLIP-seq
MIRT2495806	hsa-miR-4475	CLIP-seq
MIRT858825	hsa-miR-4658	CLIP-seq
MIRT2495807	hsa-miR-4711-5p	CLIP-seq
MIRT2495808	hsa-miR-4758-3p	CLIP-seq
MIRT2495809	hsa-miR-4771	CLIP-seq
MIRT1954973	hsa-miR-486-3p	CLIP-seq
MIRT2495810	hsa-miR-492	CLIP-seq
MIRT2495811	hsa-miR-510	CLIP-seq
MIRT858832	hsa-miR-574-5p	CLIP-seq
MIRT858833	hsa-miR-586	CLIP-seq
MIRT2495812	hsa-miR-589	CLIP-seq
MIRT2495813	hsa-miR-595	CLIP-seq

Show/Hide all (27)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000785	Component	Chromatin	IEA
GO:0000978	Function	RNA polymerase II cis-regulatory region sequence-specific DNA binding	IDA	24245781
GO:0003682	Function	Chromatin binding	IEA
GO:0003712	Function	Transcription coregulator activity	IDA	16344550
GO:0003713	Function	Transcription coactivator activity	IBA
GO:0003713	Function	Transcription coactivator activity	IEA
GO:0003713	Function	Transcription coactivator activity	IMP	16344550, 24245781
GO:0003713	Function	Transcription coactivator activity	ISS
GO:0005515	Function	Protein binding	IPI	16189514, 16344550, 25416956, 32296183, 33961781
GO:0005634	Component	Nucleus	IDA
GO:0005634	Component	Nucleus	IEA
GO:0005737	Component	Cytoplasm	IEA
GO:0005829	Component	Cytosol	IDA
GO:0007165	Process	Signal transduction	IEA
GO:0007165	Process	Signal transduction	ISS
GO:0008013	Function	Beta-catenin binding	IPI	16344550
GO:0008270	Function	Zinc ion binding	IEA
GO:0010628	Process	Positive regulation of gene expression	IDA	16344550
GO:0016055	Process	Wnt signaling pathway	IEA
GO:0030518	Process	Nuclear receptor-mediated steroid hormone signaling pathway	IEA
GO:0030518	Process	Nuclear receptor-mediated steroid hormone signaling pathway	ISS
GO:0043565	Function	Sequence-specific DNA binding	IDA	16344550
GO:0045893	Process	Positive regulation of DNA-templated transcription	IMP	16344550
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IBA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	IEA
GO:0045944	Process	Positive regulation of transcription by RNA polymerase II	ISS
GO:0046872	Function	Metal ion binding	IEA

MIM	HGNC	e!Ensembl
HGNC	N/A	HGNC

Q9P1Z2

Protein name

Calcium-binding and coiled-coil domain-containing protein 1 (Calphoglin) (Coiled-coil coactivator protein) (Sarcoma antigen NY-SAR-3)

Protein function

Functions as a coactivator for aryl hydrocarbon and nuclear receptors (NR). Recruited to promoters through its contact with the N-terminal basic helix-loop-helix-Per-Arnt-Sim (PAS) domain of transcription factors or coactivators, such as NCOA2.

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF17751	SKICH	15 → 118	SKICH domain	Domain
PF07888	CALCOCO1	122 → 596	Calcium binding and coiled-coil domain (CALCOCO1) like	Coiled-coil
PF18112	Zn-C2H2_12	654 → 680	Autophagy receptor zinc finger-C2H2 domain	Domain

Sequence

MEESPLSRAPSRGGVNFLNVARTYIPNTKVECHYTLPPGTMPSASDWIGIFKVEAACVRD
YHTFVWSSVPESTTDGSPIHTSVQFQASYLPKPGAQLYQFRYVNRQGQVCGQSPPFQFRE
PRPMDELVTLEEADGGSDILLVVPKATVLQNQLDESQQERNDLMQLKLQLEGQVTELRSR
VQELERALATARQEHTELMEQYKGISRSHGEITEERDILSRQQGDHVARILELEDDIQTI
SEKVLTKEVELDRLRDTVKALTREQEKLLGQLKEVQADKEQSEAELQVAQQENHHLNLDL
KEAKSWQEEQSAQAQRLKDKVAQMKDTLGQAQQRVAELEPLKEQLRGAQELAASSQQKAT
LLGEELASAAAARDRTIAELHRSRLEVAEVNGRLAELGLHLKEEKCQWSKERAGLLQSVE
AEKDKILKLSAEILRLEKAVQEERTQNQVFKTELAREKDSSLVQLSESKRELTELRSALR
VLQKEKEQLQEEKQELLEYMRKLEARLEKVADEKWNEDATTEDEEAAVGLSCPAALTDSE
DESPEDMRLPPYGLCERGDPGSSPAGPREASPLVVISQPAPISPHLSGPAEDSSSDSEAE
DEKSVLMAAVQSGGEEANLLLPELGSAFYDMASGFTVGTLSETSTGGPATPTWKECPICK
ERFPAESDKDALEDHMDGHFFFSTQDPFTFE

Sequence length

691

Interactions

View interactions

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (4)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
BONE FRACTURE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
EBV-positive nodal T- and NK-cell lymphoma	Likely benign	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PANIC DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PSYCHIATRIC DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (6)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Breast Neoplasms	Breast neoplasm	Pubtator	19183483	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	31104316		★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	31953347	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Panic Disorder	Panic Disorder	GWASCAT_DG	19165232		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Panic Disorder	Panic Disorder	GWASDB_DG	19165232		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Schizophrenia	Schizophrenia	Pubtator	34103471	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

CALCOCO1 (calcium binding and coiled-coil domain 1)