Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	57657
Gene name	Hyperpolarization activated cyclic nucleotide gated potassium channel 3
Gene symbol	HCN3
Synonyms (NCBI Gene)	-
Chromosome	1
Chromosome location	1q22
Summary	This gene encodes a multi-pass membrane protein that functions as a voltage gated cation channel. The encoded protein is a member of a family of closely related cyclic adenosine monophosphate-binding channel proteins. Alternative splicing results in multi

Show/Hide all (78)

miRTarBase ID	miRNA	Experiments	Reference
MIRT026503	hsa-miR-192-5p	Microarray	19074876
MIRT1042136	hsa-miR-1205	CLIP-seq
MIRT1042137	hsa-miR-1260	CLIP-seq
MIRT1042138	hsa-miR-1260b	CLIP-seq
MIRT1042139	hsa-miR-1297	CLIP-seq
MIRT1042140	hsa-miR-140-3p	CLIP-seq
MIRT1042141	hsa-miR-185	CLIP-seq
MIRT1042142	hsa-miR-188-3p	CLIP-seq
MIRT1042143	hsa-miR-1909	CLIP-seq
MIRT1042144	hsa-miR-2052	CLIP-seq
MIRT1042145	hsa-miR-2467-3p	CLIP-seq
MIRT1042146	hsa-miR-26a	CLIP-seq
MIRT1042147	hsa-miR-26b	CLIP-seq
MIRT1042148	hsa-miR-3125	CLIP-seq
MIRT1042149	hsa-miR-3132	CLIP-seq
MIRT1042150	hsa-miR-3156-3p	CLIP-seq
MIRT1042151	hsa-miR-3529	CLIP-seq
MIRT1042152	hsa-miR-3622b-5p	CLIP-seq
MIRT1042153	hsa-miR-362-5p	CLIP-seq
MIRT1042154	hsa-miR-3646	CLIP-seq
MIRT1042155	hsa-miR-379	CLIP-seq
MIRT1042156	hsa-miR-3916	CLIP-seq
MIRT1042157	hsa-miR-4257	CLIP-seq
MIRT1042158	hsa-miR-4301	CLIP-seq
MIRT1042159	hsa-miR-4306	CLIP-seq
MIRT1042160	hsa-miR-4418	CLIP-seq
MIRT1042161	hsa-miR-4434	CLIP-seq
MIRT1042162	hsa-miR-4436a	CLIP-seq
MIRT1042163	hsa-miR-4465	CLIP-seq
MIRT1042164	hsa-miR-4471	CLIP-seq
MIRT1042165	hsa-miR-4516	CLIP-seq
MIRT1042166	hsa-miR-4644	CLIP-seq
MIRT1042167	hsa-miR-4666-3p	CLIP-seq
MIRT1042168	hsa-miR-4700-3p	CLIP-seq
MIRT1042169	hsa-miR-4720-5p	CLIP-seq
MIRT1042170	hsa-miR-4797-5p	CLIP-seq
MIRT1042171	hsa-miR-4799-3p	CLIP-seq
MIRT1042172	hsa-miR-485-5p	CLIP-seq
MIRT1042173	hsa-miR-486-3p	CLIP-seq
MIRT1042174	hsa-miR-500b	CLIP-seq
MIRT1042175	hsa-miR-501-5p	CLIP-seq
MIRT1042176	hsa-miR-509-3-5p	CLIP-seq
MIRT1042177	hsa-miR-509-5p	CLIP-seq
MIRT1042178	hsa-miR-567	CLIP-seq
MIRT1042179	hsa-miR-601	CLIP-seq
MIRT1042180	hsa-miR-627	CLIP-seq
MIRT1042181	hsa-miR-629	CLIP-seq
MIRT1042182	hsa-miR-759	CLIP-seq
MIRT2008861	hsa-miR-3120-3p	CLIP-seq
MIRT2008862	hsa-miR-34a	CLIP-seq
MIRT2008863	hsa-miR-34c-5p	CLIP-seq
MIRT2008864	hsa-miR-449a	CLIP-seq
MIRT2008865	hsa-miR-449b	CLIP-seq
MIRT2008866	hsa-miR-552	CLIP-seq
MIRT2241215	hsa-miR-1197	CLIP-seq
MIRT2241216	hsa-miR-1224-5p	CLIP-seq
MIRT1042144	hsa-miR-2052	CLIP-seq
MIRT2241217	hsa-miR-3160-3p	CLIP-seq
MIRT2008862	hsa-miR-34a	CLIP-seq
MIRT2008863	hsa-miR-34c-5p	CLIP-seq
MIRT1042157	hsa-miR-4257	CLIP-seq
MIRT1042162	hsa-miR-4436a	CLIP-seq
MIRT2241218	hsa-miR-4487	CLIP-seq
MIRT2008864	hsa-miR-449a	CLIP-seq
MIRT2008865	hsa-miR-449b	CLIP-seq
MIRT2241219	hsa-miR-4751	CLIP-seq
MIRT2241220	hsa-miR-4796-3p	CLIP-seq
MIRT2241221	hsa-miR-548n	CLIP-seq
MIRT2241222	hsa-miR-548t	CLIP-seq
MIRT2241223	hsa-miR-558	CLIP-seq
MIRT1042180	hsa-miR-627	CLIP-seq
MIRT2388918	hsa-miR-31	CLIP-seq
MIRT2008862	hsa-miR-34a	CLIP-seq
MIRT2008863	hsa-miR-34c-5p	CLIP-seq
MIRT2388919	hsa-miR-3688-5p	CLIP-seq
MIRT2008864	hsa-miR-449a	CLIP-seq
MIRT2008865	hsa-miR-449b	CLIP-seq
MIRT2388920	hsa-miR-890	CLIP-seq

Show/Hide all (43)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000166	Function	Nucleotide binding	IEA
GO:0003254	Process	Regulation of membrane depolarization	IBA
GO:0003254	Process	Regulation of membrane depolarization	IDA	16043489
GO:0005216	Function	Monoatomic ion channel activity	IEA
GO:0005248	Function	Voltage-gated sodium channel activity	IDA	16043489
GO:0005248	Function	Voltage-gated sodium channel activity	IMP	22748890
GO:0005249	Function	Voltage-gated potassium channel activity	IBA
GO:0005249	Function	Voltage-gated potassium channel activity	IDA	16043489
GO:0005249	Function	Voltage-gated potassium channel activity	IEA
GO:0005249	Function	Voltage-gated potassium channel activity	IMP	22748890
GO:0005267	Function	Potassium channel activity	IEA
GO:0005272	Function	Sodium channel activity	IEA
GO:0005515	Function	Protein binding	IPI	26966193
GO:0005886	Component	Plasma membrane	IDA	22748890
GO:0005886	Component	Plasma membrane	IEA
GO:0005886	Component	Plasma membrane	TAS
GO:0006811	Process	Monoatomic ion transport	IEA
GO:0006813	Process	Potassium ion transport	IEA
GO:0006814	Process	Sodium ion transport	IEA
GO:0016020	Component	Membrane	IEA
GO:0030424	Component	Axon	IBA
GO:0030425	Component	Dendrite	IBA
GO:0030552	Function	CAMP binding	IEA
GO:0034220	Process	Monoatomic ion transmembrane transport	IEA
GO:0034702	Component	Monoatomic ion channel complex	IEA
GO:0035725	Process	Sodium ion transmembrane transport	IBA
GO:0035725	Process	Sodium ion transmembrane transport	IDA	16043489
GO:0035725	Process	Sodium ion transmembrane transport	IMP	22748890
GO:0042391	Process	Regulation of membrane potential	IMP	22748890
GO:0055085	Process	Transmembrane transport	IEA
GO:0071320	Process	Cellular response to cAMP	IDA	22748890
GO:0071320	Process	Cellular response to cAMP	IDA	16043489
GO:0071805	Process	Potassium ion transmembrane transport	IBA
GO:0071805	Process	Potassium ion transmembrane transport	IDA	16043489
GO:0071805	Process	Potassium ion transmembrane transport	IEA
GO:0071805	Process	Potassium ion transmembrane transport	IMP	22748890
GO:0086091	Process	Regulation of heart rate by cardiac conduction	NAS	16043489
GO:0098719	Process	Sodium ion import across plasma membrane	NAS	16043489
GO:0098855	Component	HCN channel complex	IBA
GO:0098855	Component	HCN channel complex	IEA
GO:0098855	Component	HCN channel complex	IPI	38636662
GO:0098907	Process	Regulation of SA node cell action potential	NAS	16043489
GO:1990573	Process	Potassium ion import across plasma membrane	NAS	16043489

MIM	HGNC	e!Ensembl
609973	19183	ENSG00000143630

Q9P1Z3

Protein name

Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 3

Protein function

Hyperpolarization-activated ion channel that are permeable to sodium and potassium ions, with an about 3:1 preference for potassium ions (PubMed:16043489). Contributes to the native pacemaker currents in heart (If) and in neurons (Ih). In partic

PDB

8INZ , 8IO0 , 8IO3

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF08412	Ion_trans_N	49 → 92	Ion transport protein N-terminal	Family
PF00520	Ion_trans	93 → 358	Ion transport protein	Family
PF00027	cNMP_binding	446 → 529	Cyclic nucleotide-binding domain	Domain

Tissue specificity

TISSUE SPECIFICITY: Detected in brain. {ECO:0000269|PubMed:16043489}.

Sequence

MEAEQRPAAGASEGATPGLEAVPPVAPPPATAASGPIPKSGPEPKRRHLGTLLQPTVNKF
SLRVFGSHKAVEIEQERVKSAGAWIIHPYSDFRFYWDLIMLLLMVGNLIVLPVGITFFKE
ENSPPWIVFNVLSDTFFLLDLVLNFRTGIVVEEGAEILLAPRAIRTRYLRTWFLVDLISS
IPVDYIFLVVELEPRLDAEVYKTARALRIVRFTKILSLLRLLRLSRLIRYIHQWEEIFHM
TYDLASAVVRIFNLIGMMLLLCHWDGCLQFLVPMLQDFPPDCWVSINHMVNHSWGRQYSH
ALFKAMSHMLCIGYGQQAPVGMPDVWLTMLSMIVGATCYAMFIGHATALIQSLDSSRRQY
QEKYKQVEQYMSFHKLPADTRQRIHEYYEHRYQGKMFDEESILGELSEPLREEIINFTCR
GLVAHMPLFAHADPSFVTAVLTKLRFEVFQPGDLVVREGSVGRKMYFIQHGLLSVLARGA
RDTRLTDGSYFGEICLLTRGRRTASVRADTYCRLYSLSVDHFNAVLEEFPMMRRAFETVA
MDRLLRIGKKNSILQRKRSEPSPGSSGGIMEQHLVQHDRDMARGVRGRAPSTGAQLSGKP
VLWEPLVHAPLQAAAVTSNVAIALTHQRGPLPLSPDSPATLLARSAWRSAGSPASPLVPV
RAGPWASTSRLPAPPARTLHASLSRAGRSQVSLLGPPPGGGGRRLGPRGRPLSASQPSLP
QRATGDGSPGRKGSGSERLPPSGLLAKPPRTAQPPRPPVPEPATPRGLQLSANM

Sequence length

774

Interactions

View interactions

	KEGG		Reactome
	GnRH secretion		HCN channels

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (1)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
DEFICIENCY OF PYRUVATE KINASE	—	Disgenet	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (5)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Breast Neoplasms	Breast neoplasm	Pubtator	34841695	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hirschsprung Disease	Hirschsprung disease	Pubtator	25987789	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hydronephrosis	Hydronephrosis	BEFREE	29436516		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	BEFREE	27824082		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	27824082	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only

HCN3 (hyperpolarization activated cyclic nucleotide gated potassium channel 3)