Gene Details | GeDiPNet - Complete Gene Info, Disease Associations & Pathways

Gene Gene information from NCBI Gene database. Gene miRNA Gene ontology Other IDs Protein Pathways Associated diseases
Entrez ID	57646
Gene name	Ubiquitin specific peptidase 28
Gene symbol	USP28
Synonyms (NCBI Gene)	-
Chromosome	11
Chromosome location	11q23.2
Summary	The protein encoded by this gene is a deubiquitinase involved in the DNA damage pathway and DNA damage-induced apoptosis. Overexpression of this gene is seen in several cancers. [provided by RefSeq, Oct 2016]

275

Show/Hide all (275)

miRTarBase ID	miRNA	Experiments	Reference
MIRT023273	hsa-miR-122-5p	Microarray	17612493
MIRT025164	hsa-miR-181a-5p	Microarray	17612493
MIRT046845	hsa-miR-221-3p	CLASH	23622248
MIRT039972	hsa-miR-615-3p	CLASH	23622248
MIRT036013	hsa-miR-1301-3p	CLASH	23622248
MIRT053200	hsa-miR-363-3p	ImmunoblotMicroarrayqRT-PCR	23389829
MIRT553047	hsa-miR-153-3p	PAR-CLIP	21572407
MIRT058232	hsa-miR-340-5p	PAR-CLIP	21572407
MIRT053200	hsa-miR-363-3p	PAR-CLIP	21572407
MIRT178956	hsa-miR-367-3p	PAR-CLIP	21572407
MIRT178957	hsa-miR-92b-3p	PAR-CLIP	21572407
MIRT178955	hsa-miR-92a-3p	PAR-CLIP	21572407
MIRT178954	hsa-miR-32-5p	PAR-CLIP	21572407
MIRT178953	hsa-miR-25-3p	PAR-CLIP	21572407
MIRT553046	hsa-miR-137	PAR-CLIP	21572407
MIRT553045	hsa-miR-4668-3p	PAR-CLIP	21572407
MIRT178960	hsa-miR-5003-3p	PAR-CLIP	21572407
MIRT178958	hsa-miR-3163	PAR-CLIP	21572407
MIRT553044	hsa-miR-4729	PAR-CLIP	21572407
MIRT553043	hsa-miR-20a-3p	PAR-CLIP	21572407
MIRT553042	hsa-miR-5589-3p	PAR-CLIP	21572407
MIRT439334	hsa-miR-106b-5p	HITS-CLIP	22473208
MIRT439332	hsa-miR-20a-5p	HITS-CLIP	22473208
MIRT439334	hsa-miR-106b-5p	HITS-CLIP	22473208
MIRT726170	hsa-miR-17-5p	HITS-CLIP	22473208
MIRT726168	hsa-miR-20b-5p	HITS-CLIP	22473208
MIRT726169	hsa-miR-93-5p	HITS-CLIP	22473208
MIRT726167	hsa-miR-519d-3p	HITS-CLIP	22473208
MIRT439332	hsa-miR-20a-5p	HITS-CLIP	22473208
MIRT553047	hsa-miR-153-3p	PAR-CLIP	21572407
MIRT058232	hsa-miR-340-5p	PAR-CLIP	21572407
MIRT053200	hsa-miR-363-3p	PAR-CLIP	21572407
MIRT178956	hsa-miR-367-3p	PAR-CLIP	21572407
MIRT178957	hsa-miR-92b-3p	PAR-CLIP	21572407
MIRT178955	hsa-miR-92a-3p	PAR-CLIP	21572407
MIRT178954	hsa-miR-32-5p	PAR-CLIP	21572407
MIRT178953	hsa-miR-25-3p	PAR-CLIP	21572407
MIRT553046	hsa-miR-137	PAR-CLIP	21572407
MIRT553045	hsa-miR-4668-3p	PAR-CLIP	21572407
MIRT178960	hsa-miR-5003-3p	PAR-CLIP	21572407
MIRT178958	hsa-miR-3163	PAR-CLIP	21572407
MIRT553044	hsa-miR-4729	PAR-CLIP	21572407
MIRT553043	hsa-miR-20a-3p	PAR-CLIP	21572407
MIRT553042	hsa-miR-5589-3p	PAR-CLIP	21572407
MIRT1478458	hsa-miR-103a	CLIP-seq
MIRT1478459	hsa-miR-106a	CLIP-seq
MIRT1478460	hsa-miR-106b	CLIP-seq
MIRT1478461	hsa-miR-107	CLIP-seq
MIRT1478462	hsa-miR-1224-5p	CLIP-seq
MIRT1478463	hsa-miR-1225-3p	CLIP-seq
MIRT1478464	hsa-miR-1231	CLIP-seq
MIRT1478465	hsa-miR-1233	CLIP-seq
MIRT1478466	hsa-miR-1237	CLIP-seq
MIRT1478467	hsa-miR-1248	CLIP-seq
MIRT1478468	hsa-miR-1273	CLIP-seq
MIRT1478469	hsa-miR-1305	CLIP-seq
MIRT1478470	hsa-miR-130a	CLIP-seq
MIRT1478471	hsa-miR-130b	CLIP-seq
MIRT1478472	hsa-miR-17	CLIP-seq
MIRT1478473	hsa-miR-1827	CLIP-seq
MIRT1478474	hsa-miR-19a	CLIP-seq
MIRT1478475	hsa-miR-19b	CLIP-seq
MIRT1478476	hsa-miR-200b	CLIP-seq
MIRT1478477	hsa-miR-200c	CLIP-seq
MIRT1478478	hsa-miR-20a	CLIP-seq
MIRT1478479	hsa-miR-20b	CLIP-seq
MIRT1478480	hsa-miR-2276	CLIP-seq
MIRT1478481	hsa-miR-25	CLIP-seq
MIRT1478482	hsa-miR-301a	CLIP-seq
MIRT1478483	hsa-miR-301b	CLIP-seq
MIRT1478484	hsa-miR-3120-5p	CLIP-seq
MIRT1478485	hsa-miR-3122	CLIP-seq
MIRT1478486	hsa-miR-3160-3p	CLIP-seq
MIRT1478487	hsa-miR-3169	CLIP-seq
MIRT1478488	hsa-miR-3170	CLIP-seq
MIRT1478489	hsa-miR-3182	CLIP-seq
MIRT1478490	hsa-miR-3194-5p	CLIP-seq
MIRT1478491	hsa-miR-32	CLIP-seq
MIRT1478492	hsa-miR-340	CLIP-seq
MIRT1478493	hsa-miR-346	CLIP-seq
MIRT1478494	hsa-miR-34b	CLIP-seq
MIRT1478495	hsa-miR-3614-5p	CLIP-seq
MIRT1478496	hsa-miR-3622a-5p	CLIP-seq
MIRT1478497	hsa-miR-363	CLIP-seq
MIRT1478498	hsa-miR-3666	CLIP-seq
MIRT1478499	hsa-miR-3669	CLIP-seq
MIRT1478500	hsa-miR-367	CLIP-seq
MIRT1478501	hsa-miR-3689a-3p	CLIP-seq
MIRT1478502	hsa-miR-3689c	CLIP-seq
MIRT1478503	hsa-miR-374c	CLIP-seq
MIRT1478504	hsa-miR-3913-5p	CLIP-seq
MIRT1478505	hsa-miR-3926	CLIP-seq
MIRT1478506	hsa-miR-3929	CLIP-seq
MIRT1478507	hsa-miR-3941	CLIP-seq
MIRT1478508	hsa-miR-4267	CLIP-seq
MIRT1478509	hsa-miR-4288	CLIP-seq
MIRT1478510	hsa-miR-429	CLIP-seq
MIRT1478511	hsa-miR-4295	CLIP-seq
MIRT1478512	hsa-miR-4419b	CLIP-seq
MIRT1478513	hsa-miR-4420	CLIP-seq
MIRT1478514	hsa-miR-4478	CLIP-seq
MIRT1478515	hsa-miR-4486	CLIP-seq
MIRT1478516	hsa-miR-4487	CLIP-seq
MIRT1478517	hsa-miR-4509	CLIP-seq
MIRT1478518	hsa-miR-4514	CLIP-seq
MIRT1478519	hsa-miR-454	CLIP-seq
MIRT1478520	hsa-miR-4643	CLIP-seq
MIRT1478521	hsa-miR-4649-3p	CLIP-seq
MIRT1478522	hsa-miR-4649-5p	CLIP-seq
MIRT1478523	hsa-miR-466	CLIP-seq
MIRT1478524	hsa-miR-4672	CLIP-seq
MIRT1478525	hsa-miR-4692	CLIP-seq
MIRT1478526	hsa-miR-4696	CLIP-seq
MIRT1478527	hsa-miR-4704-3p	CLIP-seq
MIRT1478528	hsa-miR-4724-5p	CLIP-seq
MIRT1478529	hsa-miR-4728-5p	CLIP-seq
MIRT1478530	hsa-miR-4731-3p	CLIP-seq
MIRT1478531	hsa-miR-4740-5p	CLIP-seq
MIRT1478532	hsa-miR-4744	CLIP-seq
MIRT1478533	hsa-miR-4751	CLIP-seq
MIRT1478534	hsa-miR-4768-3p	CLIP-seq
MIRT1478535	hsa-miR-4772-3p	CLIP-seq
MIRT1478536	hsa-miR-4789-3p	CLIP-seq
MIRT1478537	hsa-miR-4797-5p	CLIP-seq
MIRT1478538	hsa-miR-4801	CLIP-seq
MIRT1478539	hsa-miR-485-5p	CLIP-seq
MIRT1478540	hsa-miR-496	CLIP-seq
MIRT1478541	hsa-miR-499a-5p	CLIP-seq
MIRT1478542	hsa-miR-500a	CLIP-seq
MIRT1478543	hsa-miR-519a	CLIP-seq
MIRT1478544	hsa-miR-519b-3p	CLIP-seq
MIRT1478545	hsa-miR-519c-3p	CLIP-seq
MIRT1478546	hsa-miR-519d	CLIP-seq
MIRT1478547	hsa-miR-548s	CLIP-seq
MIRT1478548	hsa-miR-548t	CLIP-seq
MIRT1478549	hsa-miR-549	CLIP-seq
MIRT1478550	hsa-miR-558	CLIP-seq
MIRT1478551	hsa-miR-590-3p	CLIP-seq
MIRT1478552	hsa-miR-615-5p	CLIP-seq
MIRT1478553	hsa-miR-632	CLIP-seq
MIRT1478554	hsa-miR-655	CLIP-seq
MIRT1478555	hsa-miR-661	CLIP-seq
MIRT1478556	hsa-miR-665	CLIP-seq
MIRT1478557	hsa-miR-767-5p	CLIP-seq
MIRT1478558	hsa-miR-92a	CLIP-seq
MIRT1478559	hsa-miR-92b	CLIP-seq
MIRT1478560	hsa-miR-93	CLIP-seq
MIRT1478561	hsa-miR-940	CLIP-seq
MIRT1478473	hsa-miR-1827	CLIP-seq
MIRT1478496	hsa-miR-3622a-5p	CLIP-seq
MIRT1478507	hsa-miR-3941	CLIP-seq
MIRT1478523	hsa-miR-466	CLIP-seq
MIRT1478524	hsa-miR-4672	CLIP-seq
MIRT1478542	hsa-miR-500a	CLIP-seq
MIRT1478458	hsa-miR-103a	CLIP-seq
MIRT1478461	hsa-miR-107	CLIP-seq
MIRT1478468	hsa-miR-1273	CLIP-seq
MIRT2364351	hsa-miR-128	CLIP-seq
MIRT1478481	hsa-miR-25	CLIP-seq
MIRT1478488	hsa-miR-3170	CLIP-seq
MIRT1478489	hsa-miR-3182	CLIP-seq
MIRT1478490	hsa-miR-3194-5p	CLIP-seq
MIRT1478491	hsa-miR-32	CLIP-seq
MIRT2364352	hsa-miR-323-5p	CLIP-seq
MIRT1478497	hsa-miR-363	CLIP-seq
MIRT1478500	hsa-miR-367	CLIP-seq
MIRT1478503	hsa-miR-374c	CLIP-seq
MIRT1478505	hsa-miR-3926	CLIP-seq
MIRT1478507	hsa-miR-3941	CLIP-seq
MIRT1478515	hsa-miR-4486	CLIP-seq
MIRT1478522	hsa-miR-4649-5p	CLIP-seq
MIRT1478523	hsa-miR-466	CLIP-seq
MIRT1478524	hsa-miR-4672	CLIP-seq
MIRT1478528	hsa-miR-4724-5p	CLIP-seq
MIRT1478542	hsa-miR-500a	CLIP-seq
MIRT2364353	hsa-miR-501-5p	CLIP-seq
MIRT1478547	hsa-miR-548s	CLIP-seq
MIRT1478552	hsa-miR-615-5p	CLIP-seq
MIRT1478554	hsa-miR-655	CLIP-seq
MIRT1478555	hsa-miR-661	CLIP-seq
MIRT1478557	hsa-miR-767-5p	CLIP-seq
MIRT2364354	hsa-miR-876-3p	CLIP-seq
MIRT1478558	hsa-miR-92a	CLIP-seq
MIRT1478559	hsa-miR-92b	CLIP-seq
MIRT1478463	hsa-miR-1225-3p	CLIP-seq
MIRT1478465	hsa-miR-1233	CLIP-seq
MIRT1478473	hsa-miR-1827	CLIP-seq
MIRT2396741	hsa-miR-21	CLIP-seq
MIRT1478494	hsa-miR-34b	CLIP-seq
MIRT2396742	hsa-miR-3607-5p	CLIP-seq
MIRT1478495	hsa-miR-3614-5p	CLIP-seq
MIRT1478496	hsa-miR-3622a-5p	CLIP-seq
MIRT2396743	hsa-miR-4495	CLIP-seq
MIRT2396744	hsa-miR-4659a-5p	CLIP-seq
MIRT2396745	hsa-miR-4659b-5p	CLIP-seq
MIRT1478534	hsa-miR-4768-3p	CLIP-seq
MIRT2396746	hsa-miR-4769-3p	CLIP-seq
MIRT2396747	hsa-miR-545	CLIP-seq
MIRT2396748	hsa-miR-590-5p	CLIP-seq
MIRT1478556	hsa-miR-665	CLIP-seq
MIRT2463027	hsa-miR-3675-3p	CLIP-seq
MIRT2463028	hsa-miR-3934	CLIP-seq
MIRT2463029	hsa-miR-4662a-5p	CLIP-seq
MIRT2463030	hsa-miR-4676-5p	CLIP-seq
MIRT2463031	hsa-miR-548c-3p	CLIP-seq
MIRT2463032	hsa-miR-575	CLIP-seq
MIRT1478463	hsa-miR-1225-3p	CLIP-seq
MIRT1478465	hsa-miR-1233	CLIP-seq
MIRT2658130	hsa-miR-1273d	CLIP-seq
MIRT2658131	hsa-miR-1276	CLIP-seq
MIRT1478473	hsa-miR-1827	CLIP-seq
MIRT2658132	hsa-miR-1976	CLIP-seq
MIRT2396741	hsa-miR-21	CLIP-seq
MIRT2658133	hsa-miR-31	CLIP-seq
MIRT2658134	hsa-miR-3128	CLIP-seq
MIRT2364352	hsa-miR-323-5p	CLIP-seq
MIRT1478494	hsa-miR-34b	CLIP-seq
MIRT2396742	hsa-miR-3607-5p	CLIP-seq
MIRT2658135	hsa-miR-3613-3p	CLIP-seq
MIRT1478495	hsa-miR-3614-5p	CLIP-seq
MIRT1478496	hsa-miR-3622a-5p	CLIP-seq
MIRT2463027	hsa-miR-3675-3p	CLIP-seq
MIRT1478506	hsa-miR-3929	CLIP-seq
MIRT2463028	hsa-miR-3934	CLIP-seq
MIRT1478508	hsa-miR-4267	CLIP-seq
MIRT1478512	hsa-miR-4419b	CLIP-seq
MIRT1478514	hsa-miR-4478	CLIP-seq
MIRT2396743	hsa-miR-4495	CLIP-seq
MIRT1478521	hsa-miR-4649-3p	CLIP-seq
MIRT2396744	hsa-miR-4659a-5p	CLIP-seq
MIRT2396745	hsa-miR-4659b-5p	CLIP-seq
MIRT2463029	hsa-miR-4662a-5p	CLIP-seq
MIRT2463030	hsa-miR-4676-5p	CLIP-seq
MIRT1478539	hsa-miR-485-5p	CLIP-seq
MIRT2658136	hsa-miR-494	CLIP-seq
MIRT2396747	hsa-miR-545	CLIP-seq
MIRT2463031	hsa-miR-548c-3p	CLIP-seq
MIRT2658137	hsa-miR-548p	CLIP-seq
MIRT2463032	hsa-miR-575	CLIP-seq
MIRT2396748	hsa-miR-590-5p	CLIP-seq
MIRT2658138	hsa-miR-660	CLIP-seq
MIRT1478556	hsa-miR-665	CLIP-seq
MIRT2364354	hsa-miR-876-3p	CLIP-seq
MIRT2658130	hsa-miR-1273d	CLIP-seq
MIRT2658131	hsa-miR-1276	CLIP-seq
MIRT1478473	hsa-miR-1827	CLIP-seq
MIRT2658132	hsa-miR-1976	CLIP-seq
MIRT2396741	hsa-miR-21	CLIP-seq
MIRT2658133	hsa-miR-31	CLIP-seq
MIRT2658134	hsa-miR-3128	CLIP-seq
MIRT2364352	hsa-miR-323-5p	CLIP-seq
MIRT2694810	hsa-miR-335	CLIP-seq
MIRT2396742	hsa-miR-3607-5p	CLIP-seq
MIRT2658135	hsa-miR-3613-3p	CLIP-seq
MIRT1478496	hsa-miR-3622a-5p	CLIP-seq
MIRT2463027	hsa-miR-3675-3p	CLIP-seq
MIRT2463028	hsa-miR-3934	CLIP-seq
MIRT1478508	hsa-miR-4267	CLIP-seq
MIRT2396743	hsa-miR-4495	CLIP-seq
MIRT2694811	hsa-miR-4645-5p	CLIP-seq
MIRT2396744	hsa-miR-4659a-5p	CLIP-seq
MIRT2396745	hsa-miR-4659b-5p	CLIP-seq
MIRT2463029	hsa-miR-4662a-5p	CLIP-seq
MIRT2694812	hsa-miR-4673	CLIP-seq
MIRT2463030	hsa-miR-4676-5p	CLIP-seq
MIRT2694813	hsa-miR-4742-5p	CLIP-seq
MIRT2694814	hsa-miR-4755-3p	CLIP-seq
MIRT2396747	hsa-miR-545	CLIP-seq
MIRT2463031	hsa-miR-548c-3p	CLIP-seq
MIRT2658137	hsa-miR-548p	CLIP-seq
MIRT2463032	hsa-miR-575	CLIP-seq
MIRT1478551	hsa-miR-590-3p	CLIP-seq
MIRT2396748	hsa-miR-590-5p	CLIP-seq
MIRT2658138	hsa-miR-660	CLIP-seq
MIRT2364354	hsa-miR-876-3p	CLIP-seq

Show/Hide all (34)

GO ID	Ontology	Definition	Evidence	Reference
GO:0000077	Process	DNA damage checkpoint signaling	IBA
GO:0000077	Process	DNA damage checkpoint signaling	IMP	18662541
GO:0004843	Function	Cysteine-type deubiquitinase activity	IBA
GO:0004843	Function	Cysteine-type deubiquitinase activity	IDA	16901786, 17558397
GO:0004843	Function	Cysteine-type deubiquitinase activity	IEA
GO:0004843	Function	Cysteine-type deubiquitinase activity	IMP	16901786, 17558397
GO:0004843	Function	Cysteine-type deubiquitinase activity	TAS
GO:0005515	Function	Protein binding	IPI	16901786, 17558397, 17873522, 24623306
GO:0005634	Component	Nucleus	IBA
GO:0005634	Component	Nucleus	IEA
GO:0005654	Component	Nucleoplasm	IDA	17558397
GO:0005654	Component	Nucleoplasm	IEA
GO:0005654	Component	Nucleoplasm	TAS
GO:0005829	Component	Cytosol	IBA
GO:0006281	Process	DNA repair	IEA
GO:0006508	Process	Proteolysis	IEA
GO:0006974	Process	DNA damage response	IDA	17873522
GO:0006974	Process	DNA damage response	IEA
GO:0008233	Function	Peptidase activity	IEA
GO:0008234	Function	Cysteine-type peptidase activity	IEA
GO:0008283	Process	Cell population proliferation	IMP	17558397
GO:0010212	Process	Response to ionizing radiation	IDA	16901786
GO:0016579	Process	Protein deubiquitination	IDA	16901786, 17558397, 18662541
GO:0016579	Process	Protein deubiquitination	IEA
GO:0016579	Process	Protein deubiquitination	TAS
GO:0016604	Component	Nuclear body	IDA
GO:0016787	Function	Hydrolase activity	IEA
GO:0031647	Process	Regulation of protein stability	IBA
GO:0031647	Process	Regulation of protein stability	IMP	24623306
GO:0032991	Component	Protein-containing complex	IDA	17873522
GO:0034644	Process	Cellular response to UV	IDA	17873522
GO:0042771	Process	Intrinsic apoptotic signaling pathway in response to DNA damage by p53 class mediator	IDA	16901786
GO:0071947	Process	Protein deubiquitination involved in ubiquitin-dependent protein catabolic process	IMP	24623306
GO:0101005	Function	Deubiquitinase activity	IMP	24623306

MIM	HGNC	e!Ensembl
610748	12625	ENSG00000048028

Q96RU2

Protein name

Ubiquitin carboxyl-terminal hydrolase 28 (EC 3.4.19.12) (Deubiquitinating enzyme 28) (Ubiquitin thioesterase 28) (Ubiquitin-specific-processing protease 28)

Protein function

Deubiquitinase involved in DNA damage response checkpoint and MYC proto-oncogene stability. Involved in DNA damage induced apoptosis by specifically deubiquitinating proteins of the DNA damage pathway such as CLSPN. Also involved in G2 DNA damag

PDB

2LVA , 2MUU , 6H4H , 6H4I , 6HEH , 6HEI , 6HEJ , 6HEK , 7TUO , 8HJE , 8P14 , 8P19 , 8P1P , 8P1Q

Family and domains

Pfam

Accession	ID	Position in sequence	Description	Type
PF00443	UCH	162 → 647	Ubiquitin carboxyl-terminal hydrolase	Family

Sequence

MTAELQQDDAAGAADGHGSSCQMLLNQLREITGIQDPSFLHEALKASNGDITQAVSLLTD
ERVKEPSQDTVATEPSEVEGSAANKEVLAKVIDLTHDNKDDLQAAIALSLLESPKIQADG
RDLNRMHEATSAETKRSKRKRCEVWGENPNPNDWRRVDGWPVGLKNVGNTCWFSAVIQSL
FQLPEFRRLVLSYSLPQNVLENCRSHTEKRNIMFMQELQYLFALMMGSNRKFVDPSAALD
LLKGAFRSSEEQQQDVSEFTHKLLDWLEDAFQLAVNVNSPRNKSENPMVQLFYGTFLTEG
VREGKPFCNNETFGQYPLQVNGYRNLDECLEGAMVEGDVELLPSDHSVKYGQERWFTKLP
PVLTFELSRFEFNQSLGQPEKIHNKLEFPQIIYMDRYMYRSKELIRNKRECIRKLKEEIK
ILQQKLERYVKYGSGPARFPLPDMLKYVIEFASTKPASESCPPESDTHMTLPLSSVHCSV
SDQTSKESTSTESSSQDVESTFSSPEDSLPKSKPLTSSRSSMEMPSQPAPRTVTDEEINF
VKTCLQRWRSEIEQDIQDLKTCIASTTQTIEQMYCDPLLRQVPYRLHAVLVHEGQANAGH
YWAYIYNQPRQSWLKYNDISVTESSWEEVERDSYGGLRNVSAYCLMYINDKLPYFNAEAA
PTESDQMSEVEALSVELKHYIQEDNWRFEQEVEEWEEEQSCKIPQMESSTNSSSQDYSTS
QEPSVASSHGVRCLSSEHAVIVKEQTAQAIANTARAYEKSGVEAALSEVMLSPAMQGVIL
AIAKARQTFDRDGSEAGLIKAFHEEYSRLYQLAKETPTSHSDPRLQHVLVYFFQNEAPKR
VVERTLLEQFADKNLSYDERSISIMKVAQAKLKEIGPDDMNMEEYKKWHEDYSLFRKVSV
YLLTGLELYQKGKYQEALSYLVYAYQSNAALLMKGPRRGVKESVIALYRRKCLLELNAKA
ASLFETNDDHSVTEGINVMNELIIPCIHLIINNDISKDDLDAIEVMRNHWCSYLGQDIAE
NLQLCLGEFLPRLLDPSAEIIVLKEPPTIRPNSPYDLCSRFAAVMESIQGVSTVTVK

Sequence length

1077

Interactions

View interactions

	Reactome
			Ub-specific processing proteases

Evidence Score: ★☆☆☆☆ Gene-disease association found in Text Mining only ★★☆☆☆ Found in Text Mining and Unknown/Other Associations ★★★☆☆ Reported in Unknown/Other Associations across ≥2 Sources ★★★★☆ ClinVar: Pathogenic/Likely Pathogenic (<5 Variants) ★★★★★ ClinVar: Pathogenic/Likely Pathogenic (≥5 Variants)

Show/Hide Unknown Diseases (9)

Phenotype Name	Clinical Significance	Source	Evidence Score
Unknown / Other Associations ClinVar entries with uncertain/conflicting evidence, and associations from other databases (OMIM, Orphanet, GWAS, etc.) where the gene is not established as causal.
Acute myeloid leukemia	Uncertain significance	ClinVar	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATRIAL FIBRILLATION	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
ATTENTION DEFICIT HYPERACTIVITY DISORDER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CANCER	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
BREAST CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Prostate cancer	Uncertain significance	ClinVar GWAS catalog	★★★★★ ★★★☆☆ Reported in Unknown/Other Associations (≥2 sources)
PROSTATE CARCINOMA	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
PROSTATIC NEOPLASMS	—	CTD	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
SUBSTANCE ABUSE	—	GWAS catalog	★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations

Show/Hide Text Mining Associations (36)

Disease Name	Disease (Merged)	Source	PMID	Relationship Type	Evidence Score
Associations from Text Mining Disease associations identified through text mining
Bladder Neoplasm	Bladder Neoplasm	BEFREE	24347490, 29415985, 31822365		★★★★★ ★☆☆☆☆ Found in Text Mining only
Breast Carcinoma	Breast Carcinoma	BEFREE	24075993, 25656529, 29545478		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Carcinoma	Breast Carcinoma	GWASCAT_DG	29059683		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Breast Neoplasms	Breast neoplasm	Pubtator	24075993, 25656529, 27212032	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinogenesis	Carcinogenesis	Pubtator	32578360, 32927708	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Hepatocellular	Hepatocellular carcinoma	Pubtator	32053284, 37450415	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma of bladder	Bladder carcinoma	BEFREE	24347490, 29415985, 31822365		★★★★★ ★☆☆☆☆ Found in Text Mining only
Carcinoma Squamous Cell	Squamous cell carcinoma	Pubtator	34611298	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Carcinoma	Colorectal Cancer	BEFREE	24960159		★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	32578360	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Colorectal Neoplasms	Colorectal neoplasm	Pubtator	34106567	Stimulate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal carcinoma	Esophageal Carcinoma	BEFREE	30206969		★★★★★ ★☆☆☆☆ Found in Text Mining only
Esophageal Neoplasms	Esophagus Neoplasm	BEFREE	30206969		★★★★★ ★☆☆☆☆ Found in Text Mining only
Fanconi Anemia	Fanconi anemia	Pubtator	34611298	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Glioma	Glioma	Pubtator	37713468	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Hypoxia	Hypoxia	Pubtator	28515325	Inhibit	★★★★★ ★☆☆☆☆ Found in Text Mining only
Intestinal Cancer	Intestinal Cancer	BEFREE	24960159		★★★★★ ★☆☆☆☆ Found in Text Mining only
Invasive Ductal Breast Carcinoma	Invasive Duct and Lobular Carcinoma	BEFREE	29545478		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of breast	Breast Cancer	BEFREE	24075993, 29545478		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of esophagus	Esophagus Neoplasm	BEFREE	30206969		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of liver	Liver Cancer	BEFREE	29545478		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of prostate	Prostate cancer	CTD_human_DG	29610475, 29662167		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of stomach	Stomach Neoplasms	BEFREE	30485491		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant neoplasm of urinary bladder	Urinary bladder cancer	BEFREE	24347490, 29415985, 31822365		★★★★★ ★☆☆☆☆ Found in Text Mining only
Malignant Neoplasms	Malignant Neoplasm	BEFREE	24075993, 24960159, 29415985, 29545478, 30543854, 30910399		★★★★★ ★☆☆☆☆ Found in Text Mining only
Mammary Neoplasms	Mammary Neoplasms	BEFREE	24075993		★★★★★ ★☆☆☆☆ Found in Text Mining only
Melanoma	Melanoma	Pubtator	37450415	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Neoplasms	Neoplasms	BEFREE	24030976, 24960159, 25656529, 30206969, 30881015, 31822365		★★★★★ ★☆☆☆☆ Found in Text Mining only
Neuroblastoma	Neuroblastoma	Pubtator	37230388	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Non-Small Cell Lung Carcinoma	Lung carcinoma	BEFREE	25656529, 27988424, 29415985, 30881015		★★★★★ ★☆☆☆☆ Found in Text Mining only
Ovarian clear cell carcinoma	Ovarian Carcinoma	BEFREE	29707125		★★★★★ ★☆☆☆☆ Found in Text Mining only
Prostatic Neoplasms	Prostatic Neoplasms	CTD_human_DG	29610475, 29662167		★★★★★ ★★☆☆☆ Found in Text Mining + Unknown/Other Associations
Stomach Carcinoma	Stomach Carcinoma	BEFREE	30485491		★★★★★ ★☆☆☆☆ Found in Text Mining only
Triple Negative Breast Neoplasms	Triple negative breast cancer	Pubtator	34822842	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urinary Bladder Neoplasms	Urinary bladder neoplasms	Pubtator	24347490	Associate	★★★★★ ★☆☆☆☆ Found in Text Mining only
Urothelial Carcinoma	Urothelial Carcinoma	BEFREE	31822365		★★★★★ ★☆☆☆☆ Found in Text Mining only

USP28 (ubiquitin specific peptidase 28)